KEGG   Mus musculus (mouse): 57753
Entry
57753             CDS       T01002                                 

Gene name
Noc3l, AF233884, Fad24
Definition
(RefSeq) NOC3 like DNA replication regulator
  KO
K14834  nucleolar complex protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    57753 (Noc3l)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    57753 (Noc3l)
SSDB
Motif
Pfam: NOC3p CBF DUF4355
Other DBs
NCBI-GeneID: 57753
NCBI-ProteinID: NP_067290
MGI: 1932610
Ensembl: ENSMUSG00000024999
UniProt: Q8VI84
Position
19; 19 C3
AA seq 807 aa
MKARRNKKQVPSFRKLIKTSKVKLENKLKNKQFKQQSTIKKYRKEQRKLRQAVKDAVSKK
PIPLEDPKSKRPVKRMEREEDEEEEALPLDMMDEDDLQLMKDLGQKASFLTRDLSSSEPV
HIKKRKHESVIEKYEKVPRTLQTAPEKELIHLLPIKDKSGIIPQAREKPVTDVQQEEEAE
EELEDEEEVIEDPRKELTIEEHVIERKKKLQDKKIQIAALASAILSDPESHIKKLKELRS
MLMEQDPDVAVTVRKLVIISLMELFKDITPSYKIRPLTEAEKSTKIRKETQKLREFEEGL
VSQYKFYLENLEQIVKDWKQRKLKKSNVVSLKAYKGLAEVAVKSLCELLVALPHFNFHNN
IIVLIVPLMNDGSKPVSEMCCEAVKKLFKQDKLGQASLGVIKVISGFVKGRNYEVRPEML
KTFLCLRIKEVEVKKDTEDINKPKRFMTFKEKRKTLSRMQRKWKKAEEKLERELREAEAS
ESTEKKLKLHTETLNIVFVTYFRILKKAQKSPLLPAVLEGLAKFAHLINVEFFDDLLVVL
HTLIESGELSYQESLHCVQTAFHILSGQGDVLNIDPMKFYTHLYKTLFTLHAGATNDGIE
IVLHCLDVMLSKRRKQVSHQRALAFIKRLCTLALQVLPNSSIGLLATTRILMHTFPRTDL
LLDNESQGSGVFLPELEEPEYCNAQNTALWELHTLRRHYHPIVRRFAAHLLAGAPSEGSE
ALKPELSRRSAVELFETYSMAAMTFNPPVESSHSKRKDKFLPGDSFLNEDLNQLIKRYCN
EAAPETPLDFAKCLESSSRQYRVNGLS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgaaggcgagaagaaataaaaagcaggtcccaagctttcgcaagttgataaaaactagt
aaagtgaaacttgaaaacaaattgaaaaataagcaatttaaacaacaaagtaccatcaag
aagtaccgaaaagagcagaggaaactaaggcaagctgtaaaagatgctgtgtctaaaaaa
cccattccgctggaggacccaaagagcaaacggccagttaaaaggatggagagggaggag
gacgaggaggaagaagccctgcctttggatatgatggacgaggatgacctacagctgatg
aaggatttaggacaaaaggcatcttttctcacaagagatctctcttctagtgaaccagtc
catatcaagaaacgaaagcatgagagtgtgatagagaaatatgaaaaagtgccaagaact
ctgcaaaccgcaccggagaaggagttgattcacctgctccctatcaaggacaagagtggc
atcatccctcaggctcgggagaagccggtcactgacgtgcagcaagaagaggaggctgag
gaagagctggaagatgaggaagaggtcattgaagaccccaggaaggagctgaccatagaa
gagcatgtgatcgagagaaagaagaaactgcaggacaagaaaatacagattgcagcctta
gcatctgctattctgtcagatccagaaagtcatattaaaaaactgaaagagttgcgttcc
atgctgatggagcaggaccctgatgtggctgtcactgtccggaagttggttatcatctca
ctgatggagctgtttaaggacatcactccctcgtataaaatccggcctctaaccgaagca
gaaaaatctaccaagattcgtaaagaaacccagaagttaagagaatttgaagaaggcctg
gttagccaatacaaattttatttggaaaatctggagcaaatagttaaagactggaagcaa
aggaagctgaagaagagcaatgtggtgtccttaaaggcctacaaagggctggctgaagtg
gcagtgaagagcctgtgtgagctgttggtggccctgccccattttaactttcacaacaac
atcattgtactgattgtccctctgatgaacgatgggtcaaaaccggtatctgaaatgtgt
tgcgaagcagtaaagaaactctttaaacaagataaattaggccaagcttctctgggtgtc
attaaagtcatctctggttttgtaaagggcagaaattacgaagttaggccagagatgtta
aaaacatttttatgcctgcggatcaaggaggtagaagtgaaaaaagatacagaggacatt
aacaagcccaaaaggttcatgactttcaaggagaagagaaaaactctatcaagaatgcaa
agaaagtggaagaaagcagaagagaaactagagcgggaacttcgggaggccgaagcttcg
gaaagcactgagaaaaagctgaaactgcacaccgagactctgaatattgtgtttgtgacc
tacttcagaatactgaagaaggcccagaagtcacctcttctgccagcggttctagaaggc
cttgccaagtttgcacatcttataaatgtggagttttttgatgatttattagtggttctt
cataccctcattgagtctggggagctaagttatcaagaaagtctccactgtgttcaaact
gcttttcatattctttctggacaaggtgatgttttaaatattgacccgatgaaattctat
acacatctctacaagacactgttcacattacatgcaggtgccaccaacgacggcattgag
attgtgctccactgcctcgatgtcatgctaagcaagcgcagaaagcaggtttctcatcag
cgagctcttgccttcatcaaacgcctttgtacacttgctctgcaggttcttccaaattca
agcattggccttttagcaactaccaggatattgatgcatacttttcccagaacagatctc
ttgcttgataacgagtctcagggcagcggggtgtttctacctgagctggaggagccagag
tactgtaatgcacagaacaccgcactgtgggagctgcacacgcttcggagacattaccat
cccattgtgcgaaggtttgcagcacatctgcttgctggggcaccatccgaaggctctgag
gccctcaagcccgagctgagccgaagatctgcagttgaactttttgagacttacagcatg
gcagcaatgacattcaatccgcctgttgaatcttcacactccaaaaggaaggataaattt
ttaccaggagactcatttttgaatgaagatttaaatcaactaatcaaaagatactgtaat
gaagctgctcctgagacaccgctggatttcgccaagtgtttggaaagctcatcccggcag
tacagagtgaatggactgtcttag

DBGET integrated database retrieval system