KEGG   Mus musculus (house mouse): 57754
Entry
57754             CDS       T01002                                 
Symbol
Cend1, 1500001H12Rik, AI415214, BM88
Name
(RefSeq) cell cycle exit and neuronal differentiation 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CEND1
Other DBs
NCBI-GeneID: 57754
NCBI-ProteinID: NP_067291
MGI: 1929898
Ensembl: ENSMUSG00000060240
UniProt: Q9JKC6
Position
7:complement(141006359..141009475)
AA seq 149 aa
MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDTQAEKQEQAAAPGPAAT
KKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDATSEPKGPGDGAEEDESNTGGRGPWPCE
NLTPLLVAGGVAVATIALILGVAFLARKK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggaatcccgaggaaagtcagccagcagccccaagccagataccaaggtgcctcaggcc
acagctgaggccaaggccactccagctgcggatgggaaagctcccttgaccaagcctgtg
aagaaggacacccaagcagagaagcaggagcaagcagcagcccctgggccagccgctacg
aagaagacaccagccaaggcagatcctgtacttctcaacaaccacagcaacctgaagcca
gctcccacagtgccggcagcccccagcagtcctgatgcaacctcagagcccaagggtcct
ggggatggggcagaggaggacgagtccaacactggaggccgaggtccctggccttgtgag
aacttgacccctttgctggtagctgggggtgtggccgtggccaccatagctctaattctt
ggtgtggcctttctagcccggaaaaaatga

DBGET integrated database retrieval system