KEGG   Mus musculus (mouse): 57773
Entry
57773             CDS       T01002                                 

Gene name
Wdr4, AI415180, AI448349, D530049K22Rik, Wh, mWH
Definition
(RefSeq) WD repeat domain 4
  KO
K15443  tRNA (guanine-N(7)-)-methyltransferase subunit TRM82
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    57773 (Wdr4)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    57773 (Wdr4)
SSDB
Motif
Pfam: WD40 Nup160
Other DBs
NCBI-GeneID: 57773
NCBI-ProteinID: NP_067297
MGI: 1889002
Ensembl: ENSMUSG00000024037
Vega: OTTMUSG00000035223
UniProt: Q9EP82 E9Q156
Position
17; 17 B1
AA seq 456 aa
MRLRPARMLLDGTPFARRRVTSLTSANRKGAARRTCPEAAGGPMASSAGLALCAQTLVVR
GGSRFLAFSTTGSDDDCVFTYDCSTAEKKATPEDKGEDGQPADTGSDSILASTFSKSGRY
FALTDDSKRLILFRTKPWQCLSVRMVVRRCTALTFTASEDRVLVADKSGDVYSFSVLEPD
GCGRLELGHLSMLLDVAVSPDDQFVLTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRIL
VVPSHPELLLSSSGDGTLRLWEYRSGRQLQCCDLAGLQEPGEQPGHKGLAASRIAFWGQE
SYVVLLCECVPVVFVFQLDASRQQLVFRQRLTFPHRVWDVVFEEARGLWVLQDCRDAPLV
LWRPVGGEWQAAPDGAVSPRLCSHLRESWAMLEGSVGTDDSFRSLYKATFDNMTSYLKKK
EERLQQQLKKKRQRSPFPGSPEQTKKACPGQSALSC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagactacgccctgcgcgcatgctcctggacggcacgccgttcgcgcggcgccgagtg
acatcactgacaagcgccaacaggaagggcgcagcgcgtcgcacgtgtccggaggcggcg
ggcgggcccatggcgagctctgcggggctggcactgtgcgcccagacgctggtggtgcga
ggaggcagccggttcctagccttctccactacgggcagtgatgatgactgtgtcttcaca
tacgactgcagtactgcagagaagaaggccacgccagaagataaaggggaggacggacag
cccgcagacacagggagtgactcgattctggcgtccaccttctccaagtctggccgctat
tttgctttaacagatgacagtaagcgtctgattcttttccgtacaaaaccatggcaatgt
ctgagtgtcaggatggtggtgcggaggtgcaccgccctgaccttcacagcctcagaggac
cgagtcttggtggctgacaagtctggagacgtctactccttttcggtgctggagccagat
ggatgtggcaggctggagcttgggcacctctccatgctgctagacgtggctgtgagtcct
gatgaccagtttgtgcttactgcagaccgggatgagaagatccgggtcagctgggctgct
gccccgcatagcatcgagtctttctgcctgggacacactgagtttgtgagccgcatcctt
gtagtgcccagtcatcctgaactgctgctttcttcctctggggatggcaccctgagactc
tgggagtacagaagcggtaggcagctgcagtgctgtgacctggccggcctacaggagcct
ggagagcagccaggccacaaggggttggccgcgtccaggattgcattctggggacaggag
agctatgtggtgcttctgtgtgagtgcgttcccgtggtcttcgtcttccagcttgatgcc
agcagacagcagctggtgttcagacagcggctgactttccctcaccgagtgtgggatgtt
gtgtttgaggaggcccgggggctgtgggttctacaggactgccgtgatgcccccctggtg
ctctggaggcctgtgggtggtgagtggcaggctgctccagacggtgctgtgtccccgaga
ctctgcagccatctccgtgagagctgggccatgctggaaggttctgttggtacagatgac
agcttccgcagcctgtacaaggccacctttgacaacatgacctcttacctgaagaaaaag
gaagagagactgcagcagcagctgaagaagaagcggcaaaggagccccttcccagggtcc
ccggaacagaccaaaaaggcgtgcccgggccagtcagcccttagttgctga

DBGET integrated database retrieval system