KEGG   Mus musculus (house mouse): 57780
Entry
57780             CDS       T01002                                 
Symbol
Fxyd7, 1110035I01Rik
Name
(RefSeq) FXYD domain-containing ion transport regulator 7
  KO
K13364  FXYD domain-containing ion transport regulator 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    57780 (Fxyd7)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   FXYD proteins
    57780 (Fxyd7)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 ECSCR
Other DBs
NCBI-GeneID: 57780
NCBI-ProteinID: NP_071290
MGI: 1889006
Ensembl: ENSMUSG00000036578
UniProt: P59648
Position
7:complement(30741940..30750879)
AA seq 80 aa
MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSES
PTCKSCKSELPSSAPGGGGV
NT seq 243 nt   +upstreamnt  +downstreamnt
atggccaccccaacccagagccccacaaacgttcctgaagaaacagatccttttttctat
gactatgccactgtgcagactgtggggatgaccctggccactatcatgttcgtgctgggg
atcatcatcatcctgagcaagaaggtgaagtgcaggaaggcggattccaggtctgagagc
ccaacatgcaaatcctgtaagtcggaactgccctcctcagcccctggaggtggcggtgtg
tag

DBGET integrated database retrieval system