KEGG   Mus musculus (mouse): 57784
Entry
57784             CDS       T01002                                 

Gene name
Bin3, 1700015F07Rik
Definition
(RefSeq) bridging integrator 3
  KO
K20120  bridging integrator 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    57784 (Bin3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    57784 (Bin3)
SSDB
Motif
Pfam: BAR Vps5 BAR_3 DUF4743 DUF4665
Other DBs
NCBI-GeneID: 57784
NCBI-ProteinID: NP_067303
MGI: 1929883
Ensembl: ENSMUSG00000022089
UniProt: Q9JI08
Position
14; 14 D2
AA seq 253 aa
MSWIPFKIGQPKKQIVSKTVERDFEREYGKLQQLEEQTKRLQKDMKKSTDADLAMSKSAV
KISQDLLSNPLCEQDQDFLHMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFSSIFPS
LNMAVKRREQALQDYGRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNKQLL
DEMPRFYGSRLDYFQPSFESLIRAQVIYYSEMHKIFGDLTQQLDQPGHSDEQRERENETK
LSELRALSIVADD
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagctggattccatttaagatcgggcagcccaagaagcagattgtttccaaaacagtg
gagagagactttgaaagggagtatggaaaactgcagcagctggaagagcaaactaaacgc
ctgcagaaggacatgaagaaaagcaccgatgccgacctggccatgtccaaatctgctgtg
aagatatcccaggacctactgtccaacccactgtgtgagcaggaccaggactttctgcac
atggtgacagccctagacacagccatgaaacggatggatgccttcaaccaggagaaggtg
aaccagatccaaaagacagtgattgaacctctgaaaaagttcagcagcatattcccaagc
ctcaacatggcggtgaagcggcgggagcaggccttgcaggactacgggaggctgcaggcc
aaggtggagaagtacgaggaaaaggagaagactggccccgtgctggccaagctccaccag
gcccgagaagagctacgtcctgtgcgggaagactttgaggccaagaataaacaactcctg
gatgagatgccgcggttctatggcagccgacttgactatttccaacccagctttgagtcc
ctgatccgggcacaggttatatactactcagaaatgcataagatctttggagacctgacc
cagcagcttgaccagccaggccactcagatgagcagcgagagcgggaaaatgagaccaaa
ctaagtgaactccgagccctctccatcgtggctgatgactga

DBGET integrated database retrieval system