KEGG   Mus musculus (mouse): 57810
Entry
57810             CDS       T01002                                 

Gene name
Cdon, CDO, Cd0, Orcam
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    57810 (Cdon)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_4 Ig_5 Ig_6 Pur_ac_phosph_N Izumo-Ig Receptor_2B4
Other DBs
NCBI-GeneID: 57810
NCBI-ProteinID: NP_067314
MGI: 1926387
Ensembl: ENSMUSG00000038119
Vega: OTTMUSG00000030743
UniProt: Q32MD9
Position
9; 9 A4
AA seq 1250 aa
MHPDLGPLWTLLYVLVILCSSVSSDLAPYFISEPLSAVQKLGRPVVLHCSAKPVTARISW
LHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAVVSGPATVSAAALGDF
DSSTMHVITAEEKNTGFIGCRVPESNPKAEVRYKIRGKWLKHSTGNYIILPSGNLQVLNV
SSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSNGFHILHPALSQALAVLPHSPVTL
ECVVSGVPASQVYWLKDGQDAVAGSNWRRLYSHLATASIDPADSGNYSCVVGNKSGDVKH
VTYMVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNRTWFHNAQPIHPSSRHLTE
GNVLKITRVVMEDSGLYQCVADNGIGFMQSTGRLQIEQDSGWKPVIVTAPANIEVMDGDF
VTLSCNATGVPVPVIHWYGRHGLITSHPSQVLRSKPRKSHLFRPGDLDLEPVYLIMSQAG
SSSLSIQAVTLEHAGKYTCEATNKHGSTQSEAFLTVVPFETNTKAESVTPSEASQNDERD
PQDGSESSLLNLFPVKVHPSGVELPAERNASVPDAPNILSPPQTHMPDTYNLVWRAGRDG
GMPINAYFVKYRKLDDGSGAVGSWHTVRVPGSENELHLTELEPSSLYEVLMVARSAVGEG
QPAMLTFRTSKEKMASSKNTQASFPPVGVPKRPVTAEASNSNFGVVLTDSSRHSGVPEAP
DRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRMRTSDWLVAAEDIPPSKLSVEVRS
LEPGSIYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQIM
LKWTYVPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIKM
QCFNEGGESEFSNVMICETKVKRVPGASDYPVKELSTPPSSSGNAGNVGPATSPARSSDM
LYLIVGCVLGVMVLILMVFIALCLWKSRQQSTIQKYDPPGYLYQGSEINGQMVEYTTLSG
AARINGSVHGGFLSNGCSHLHHKGPSGVNGTLSGNINGGLYSAHTNSLTRACVEFEHPHH
LVNSGGVYTAVPQMDPLECINCRNCRNNNRCFTKTNSPLPVVPVVASYPQGGLEMKPLNA
MKVPVCPASTVPDHGQLPDDCVKDSVAPIPTQHTCCQDNISDINSDSTEDTAEFSRGDSS
GHSEAEDKVFSWNPLILSPVLEDCGEKTARSPPGPPLDGLSVVLQQAQET
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgcatccagacctcggacccttatggacattgctgtatgttcttgtgattctgtgttct
tctgtgagctcagacttggcaccttattttatttctgagccactctctgctgtccagaag
cttggtagacccgtggtcctacattgttctgctaaacctgttactgcccgaatctcatgg
ttgcataatggaaaacggttggacagaaacacagaacagataaagattcatcgggggact
ttgaccattctgtctcttaacccttccctttctggttgctaccagtgcgttgccaacaac
agcgttggtgccgttgtgagcggccccgcaacagtgtccgctgcagccctgggtgatttc
gattcatcaacaatgcacgttattactgcagaagagaaaaacacaggcttcattggctgc
agggtaccagagagtaaccccaaagctgaggtgcgctataagatccggggaaagtggctg
aagcattccacagggaactacataatccttccctcaggaaaccttcaggttctgaatgtg
tcctctaaggataagggatcctacaaatgtgctgcctataaccctgtcaccagtgaactg
aaggttgagcccactggccggaagctccttgtgagtcgtccttcctcgaatggctttcac
attcttcaccctgctctttctcaggcattagctgtccttcctcacagccccgttaccttg
gagtgtgtggtgagtggggttccggcctcacaagtgtattggctgaaggacggtcaggat
gccgtggcaggaagcaactggagaaggctgtactctcatctggccacagctagcatcgac
ccagcggattcggggaactattcctgtgtggtgggcaacaagtccggagatgtgaaacac
gtcacttacatggtcaatgtactggagcatgcgtcaatttctaaagggctgcacgatcag
aaggtgtccctgggggccaccgtacattttacctgtgatgttcatgggaacccagccccc
aaccgcacctggtttcataacgcacagcctatccacccctcctcacggcatctcactgaa
ggaaacgtgctgaagatcacccgggttgtcatggaagattctgggctatatcagtgcgta
gcagacaatggcattggattcatgcagtctactgggagacttcaaattgaacaagacagt
ggatggaagcctgttattgtcaccgcaccagcaaacatagaggtgatggatggagacttt
gtgactttgtcttgtaatgccaccggagtgcctgtcccagtcattcattggtacggccgc
catggattgataaccagccatccatctcaggtccttaggtccaaaccccgaaagtcccac
ctgttccggcctggggacctggacctggagcctgtctacctcatcatgtcccaagctggc
tcgagctctctgtctattcaggcagtcactctggagcatgctgggaaatatacttgtgaa
gctacaaacaaacatggcagcacacagtcagaagcattcctcacagttgttcctttcgag
acaaacacaaaggcagagtcagtcacaccttctgaagcttctcagaatgatgagcgagac
ccacaagacggttcagagtccagcctgctgaacttgtttccagtgaaggtgcatcccagt
ggagtggaattgccagcagagagaaatgcctcggtccccgatgctcctaacatactgagc
cccccacagactcacatgccagacacgtacaacctggtgtggagggcagggagggatggc
ggaatgcccatcaacgcctatttcgtgaagtaccgaaagctggacgatggtagtggtgca
gtgggcagctggcacacagttcgtgtcccagggagtgaaaatgagctgcatctaactgag
ctggagccatcaagtctctatgaagttttgatggtggctagaagtgcagttggtgaagga
cagcctgccatgcttaccttccggaccagcaaagaaaaaatggcgtcatcaaaaaacacc
caggcctcctttccgcctgtgggcgtccccaagcggcctgttactgcagaggcttccaac
agcaattttggagttgtgcttacggattcctccaggcatagtggagtcccagaggcacca
gatcgacctactatctctatggcgtcggagacctcagtctatgtcacctggattccccga
gcaaatggtggctctcccatcaccgccttcaaggtggaatataaacggatgagaactagt
gattggctggtagcggctgaagacattcctccttccaaactctctgtggaagttcgtagt
ttagagccaggttcaatatacaaatttagggtcattgctatcaaccattacggtgagagt
tttcggagctcagcatcccgtccttaccaggtggccggcttcccaaatcgtttttccaat
cgcccaataactggacctcacatcgcatacacagaggctgttagcgacactcagatcatg
ctgaaatggacgtatgttccatcaagtaacaataatactcccattcaaggattctatatc
tactaccggccaacagacagtgacaatgacagtgactacaagagagacgttgtggaaggc
tcaaagcagtggcacaccattggtcacctgcagccagagacctcctatgacattaagatg
cagtgctttaatgaaggaggggagagtgagttcagcaacgtgatgatctgcgagactaaa
gtaaaacgtgttcctggagcttccgactatcccgtgaaagagttgagtacccctcccagt
tcctcgggaaacgcagggaacgtggggcctgcaaccagccccgccaggagcagcgatatg
ttgtacctcatcgttggctgtgtgcttggggttatggtcctcattcttatggttttcatt
gcgctgtgtctgtggaagagtcgccaacagagcaccatacagaaatatgatcctccagga
tatctctaccaggggtcagagattaatgggcagatggtagagtataccactctctcagga
gcagcccggatcaacgggagtgttcacggaggcttcctcagcaatggctgttctcatctg
caccataaaggccccagtggagtcaacgggaccctgagtggaaacataaatggaggcctt
tattctgcacacacaaactccctgaccagggcgtgtgtggagtttgagcatcctcaccat
ctagtgaatagtggaggagtgtacacagccgtccctcagatggacccactggaatgcatt
aattgtcggaattgccggaacaacaataggtgtttcaccaaaaccaacagtccccttcct
gtggtcccagtggtagcctcttatcctcagggtggtctggaaatgaagcccctcaatgcc
atgaaggtgcctgtgtgcccagcttccacagttcctgaccatggccagttacctgacgat
tgtgtcaaggacagtgtggcaccaatacctacccagcatacttgctgccaggacaacata
agtgacatcaattctgattccacagaagacacagcagagttcagcagaggagacagcagt
ggtcattctgaagcagaggacaaagttttcagttggaatcctcttattttgtcacctgtc
ttggaggactgtggtgagaagacagcgaggtctccccctggacctcctctagacgggctg
tcggtggtccttcagcaagcccaagagacctga

DBGET integrated database retrieval system