KEGG   Mus musculus (house mouse): 57814
Entry
57814             CDS       T01002                                 
Symbol
Kcne4, AW487937, MiRP3
Name
(RefSeq) potassium voltage-gated channel, Isk-related subfamily, gene 4
  KO
K04898  potassium voltage-gated channel Isk-related subfamily E member 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    57814 (Kcne4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   57814 (Kcne4)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 57814
NCBI-ProteinID: NP_067317
MGI: 1891125
Ensembl: ENSMUSG00000047330
Vega: OTTMUSG00000047860
UniProt: Q9WTW3
Position
1:78794628..78797749
AA seq 170 aa
MLRMEPLNSTYPSAAASSSPLESHVPSNSSGNGNEYFYILVVMSFYGVFLIGIMLGYMKS
KRREKKSSLLLLYKDEERLWGEAMKPLPMMSGLRSGQVPMMLNMLQESVAPALSCTLCSM
EGDSVSSESSSPDVHLPIQEEGADDELEETSETPLNDSSEGSSENIHQNS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgctgaggatggagcctctgaacagcacataccccagcgctgcagcctccagcagcccc
ctcgagtcccatgtgcctagtaacagcagtggtaatggcaatgaatacttctatattttg
gtcgttatgtccttctatggcgttttcctgatcggaatcatgctgggctacatgaaatcc
aagaggcgggagaagaagtccagccttctgctgttgtacaaagacgaggagaggctgtgg
ggggaggctatgaagccgctacctatgatgtccggcttgaggtcagggcaggtgcccatg
atgctgaatatgctgcaggagagtgtggcgccggcactgtcctgcactctttgctcgatg
gaaggggacagtgtgagctccgagtcctcctctcctgatgtgcaccttcccatccaggag
gagggggctgatgacgagctggaggagacctccgagacgcctctcaacgacagcagtgaa
ggctcttccgagaacatccaccagaattcctag

DBGET integrated database retrieval system