KEGG   Mus musculus (mouse): 57875
Entry
57875             CDS       T01002                                 

Gene name
Angptl4, Arp4, Bk89, FI, Fiaf, HF, Hfarp, NG2, Ng27, Pgar, Pgarg, Pp1158
Definition
(RefSeq) angiopoietin-like 4
  KO
K08767  angiopoietin-like 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    57875 (Angptl4)
  09154 Digestive system
   04979 Cholesterol metabolism
    57875 (Angptl4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   57875 (Angptl4)
SSDB
Motif
Pfam: Fibrinogen_C UPF0242 SlyX HrpJ Spc7 DUF16 COG5 Fib_alpha HrpB7 DivIC
Other DBs
NCBI-GeneID: 57875
NCBI-ProteinID: NP_065606
MGI: 1888999
Ensembl: ENSMUSG00000002289
Vega: OTTMUSG00000037206
UniProt: Q9Z1P8
Position
17; 17 B1
AA seq 410 aa
MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVE
RTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKI
QQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTP
NATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVD
FNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGE
DTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSH
SNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgcgctgcgctccgacagcaggcgctgccctggtgctatgcgcggctactgcggggctt
ttgagcgcgcaagggcgccctgcacagccagagccaccgcgctttgcatcctgggacgag
atgaacttgctggctcacgggctgctacagctcggccatgggctgcgcgaacacgtggag
cgcacccgtgggcagctgggcgcgctggagcgccgcatggctgcctgtggtaacgcttgt
caggggcccaagggaaaagatgcacccttcaaagactccgaggatagagtccctgaaggc
cagactcctgagactctgcagagtttgcagactcagctcaaggctcaaaacagcaagatc
cagcaattgttccagaaggtggcccagcagcagagatacctatcaaagcagaatctgaga
atacagaatcttcagagccagatagacctcttggcccccacgcacctagacaatggagta
gacaagacttcgaggggaaagaggcttcccaagatgacccagctcattggcttgactccc
aacgccacccacttacacaggccgccccgggactgccaggaactcttccaagaaggggag
cggcacagtggacttttccagatccagcctctggggtctccaccatttttggtcaactgt
gagatgacttcagatggaggctggacagtgattcagagacgcctgaacggctctgtggac
ttcaaccagtcctgggaagcctacaaggatggcttcggagatccccaaggcgagttctgg
ctgggcctggaaaagatgcacagcatcacagggaaccgaggaagccaattggctgtgcag
ctccaggactgggatggcaatgccaaattgctccaatttcccatccatttggggggtgag
gacacagcctacagcctgcagctcactgagcccacggccaatgagctgggtgccaccaat
gtttcccccaatggcctttccctgcccttctctacttgggaccaagaccatgacctccgt
ggggaccttaactgtgccaagagcctctctggtggctggtggtttggtacctgtagccat
tccaatctcaatggacaatacttccactctatcccacggcaacggcaggagcgtaaaaag
ggtatcttctggaaaacatggaagggccgctactatcctctgcaggctaccaccctgctg
atccagcccatggaggctacagcagcctcttag

DBGET integrated database retrieval system