KEGG   Mus musculus (mouse): 57895
Entry
57895             CDS       T01002                                 

Symbol
Ccdc126, 6330407D12Rik, AA675040, AI465320, AL022711
Name
(RefSeq) coiled-coil domain containing 126
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4525
Other DBs
NCBI-GeneID: 57895
NCBI-ProteinID: NP_780307
MGI: 1889376
Ensembl: ENSMUSG00000050786
Vega: OTTMUSG00000022930
UniProt: Q8BIS8
Position
6:49296204..49318521
AA seq 140 aa
MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKLREQILDLSKRYVKAL
AEESRSTADVDSGASMAGYADLKRTIAVLLDDILQRLVKLESKVDYIVVNGSATNTTNGT
NGNLVPVTTNKRTSVSGSVR
NT seq 423 nt   +upstreamnt  +downstreamnt
atgttccgtacaatctcaaggaaaaatatgtcccagaagctgagcttcctgttgttggtg
ttcggactcatctgggggctgatgctacttcactacactttgcaacagccgcggcggcag
agcagcgtcaagcttcgtgagcaaatcctagatttaagcaaaagatacgtgaaagctctg
gcggaggagagcaggagcacggcggatgtggacagcggcgcgtccatggcaggctatgct
gatctgaagagaacgattgcagtcctcttagatgacattttgcagcgcttggtgaagctg
gagagcaaagtcgactatattgttgtgaacggttcagccaccaacactaccaatggcacc
aatgggaatttggtgccggtaacgaccaacaaaaggacgagtgtttcgggcagcgtcaga
tag

DBGET integrated database retrieval system