KEGG   Mus musculus (mouse): 57905
Entry
57905             CDS       T01002                                 

Symbol
Isy1, 5830446M03Rik, AI181014, AU020769
Name
(RefSeq) ISY1 splicing factor homolog
  KO
K12870  pre-mRNA-splicing factor ISY1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    57905 (Isy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    57905 (Isy1)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    57905 (Isy1)
 Complex C
    57905 (Isy1)
SSDB
Motif
Pfam: Isy1 DUF4746 CDC45
Other DBs
NCBI-GeneID: 57905
NCBI-ProteinID: NP_598695
MGI: 1923310
Ensembl: ENSMUSG00000030056
Vega: OTTMUSG00000057272
UniProt: Q69ZQ2
Structure
PDB: 
1X4T

Position
6; 6 D1
AA seq 285 aa
MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQI
QNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGY
KYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKK
LRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGNQEKAGEDGQQKFI
AHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEAKRLLGY
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcccgaaatgcagaaaaagccatgactgccctggcgaggtttcgtcaagctcagctg
gaagagggaaaagtcaaggaacggagacccttccttgcttctgaatgtactgagttgccg
aaagcggagaagtggagacggcagatcattggcgagatctcaaaaaaggttgctcagatt
cagaatgctggcttaggggaattccgaattcgggacctgaatgacgaaattaacaagctg
ctgagggagaaaggacactgggaggtccgcatcaaggagctgggcggtcctgattatgga
aaagttggccccaagatgctggatcatgaaggtaaagaagtcccaggaaatcgaggttac
aagtactttggggcagcaaaagatttgcctggtgtcagagagctatttgagaaagaaccc
cttcctcctcccagaaagacacgtgctgagctcatgaaggccatcgattttgagtactat
ggttacctggatgaagatgatggagttattgtgcccttggaacaagagtatgagaagaaa
ctcagagctgagctggtggaaaaatggaaggcagagagagaagctcggctggcaagggga
gaaaaggaagaggaggaggaggaggaagaggagatcaacatctatgctgtcacggaggag
gagtctgatgaggaaggcaaccaggagaaggccggggaagatggtcagcagaagttcatt
gctcatgtgccggtgccatctcagcaggagattgaggaggcgcttgtacggaggaagaaa
atggaactgctccagaaatatgcaagtgagaccctgcaggcacagagtgaagaagccaag
cgactcctggggtactag

DBGET integrated database retrieval system