KEGG   Mus musculus (mouse): 57908
Entry
57908             CDS       T01002                                 

Symbol
Zfp318, 2610034E08Rik, D530032D06Rik, TZF, Znf318
Name
(RefSeq) zinc finger protein 318
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-U1 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 57908
NCBI-ProteinID: NP_997554
MGI: 1889348
Ensembl: ENSMUSG00000015597
Vega: OTTMUSG00000023200
UniProt: Q99PP2
Position
17; 17 C
AA seq 2237 aa
MYRSGSRSSVSSHRSKDGSASGPPPGRPVGASSGPTRRPSSPPPPSCSSLRLPARRHRSP
SGHRGRWASPSPPRGRRGSPSPPRGRRASPSPTRGRRASPSPPRGRRGSPSPPRARRGSP
SPPRSRRHYPPGLGGFRGSIRGESRADFARDGRGDHPGGGGGSRRRSPGLCSDSSLEESL
RITVGNDHFCVSTPERRRLSDRLGSPVDGLQDMDRDDLTDDSVFTRSSQCSRGLERYISR
EEGPLSPFLGQLDEDYRTRETFLHRPEFSPQSSCHDELLRGTERNRDKLKSSSYSIRSEE
RSREAKRPRYDDTEKVHSSGGDHSSFTSGTRNYRQRRSSPSPRFLDPEFRELDLARRKRE
EEEEQSRSLSQELVGVGDDQIGCSIPGLAGVLTTSEPGYSLQRPEEVPMMPKKSILKKRI
EADMKPSLQLESFSSGASSGEDHPLYSEHSPLPLSGAIAAFTSEIENKGTTVEADLKEPQ
SNLYQWGPLREIPKDNSEKFDSFLGFKEKLDLKAEGLEQQTDFLLPHERASQDGSGFSRI
LSMLADPTITQEKRRRSFPDIEDEEKFLYGDEEEDIKSESPLKSLEDPESAGTRQKANSL
PSTPAVKLESLEESNPEYAKIHNLLKTIGLDIGVAEIGKLAARTQERLHGKKPSSRPSAD
RRLSADRHLSGDRHFSADRCSSVEHSFTADWRSSDPHRPESRETHHSNTQSPEVSHPHPA
SPVDPYLRTKNSPPFLKSDHPVCHVSGPEVVGSGFQSSVAVRCMLPSAPSTPIRLPHSAA
LSQFHIPGASQFAAARIPPNYQGSVIPSASFDAYRHYMAYAASRWPMYPASQPPSHPLSD
PHRLLPVTKQAARSRPNLRVIPTVTPAKPKQEIPVLGSISVKRIPVRVSIPSLIKYNPKK
ISDEKNRASQKQKVIEEREKLKTEQEARQKKMFYLTTELERLHKQQGEMLRKKRREKDGH
KDPLLMEVSRLQDSIMKDIAELHKETEEAEKKQSELDKVAQILGIDIFDKSLKSSNDSKE
STEKPEKEKSKSPEKELSPSNSSSSNKESKMNEKSCIKSPSSTESLQPTVKQSDQPVAAY
EYYDAGSHWCKDCNTTCGTMFDFFTHMHNKKHTQTLDPYNRPWASKTQSEAKQDTVKRTD
KITVPAKGSEFLIPVTGFYCQLCEEFLGDPISGEQHVKGHQHNENYKKYVEENPLYEERR
NLDRQAGLAVVLETERRRQNELKRKLNEKPKEEKIEKKARIVREVKEDDKAPGELEEQLS
EDGSAPEKGEVKGNASLRPQVKEEVKKEPSVASIAASFGKFSWKKPEKEEEKGSVVTPGA
PKEDTVETSKDRDDGKAEVGKAKPIKIKLSGKTVIAHTSPWTPVVTTSTQTKIRPNLPIP
STVLRKSGSATVSKPAPLNTFLSIKSSGTSTKPLPVVKESSSDLLLPPDIISKAFGGEEV
VLKGSPEEKVELAEKNEPSQVPEQMLALLPPPPPPPPPPPPPPPPPPPQAVPQLSAPSPA
QANVVLTPVKSNSVISQTFSLGFQGPNILNPGLPVAFMASEQPTVIPSDETAPGVSESDW
DQTLISMLVRPPPPLSSVFSEQAKKLEKRNSCLATANAKDLYDIFYSSGGKGAHETKLSS
STLANGESSSLPRTESSDFSSTCTLNSSMSSEDLPQCSALVTATEISNLENPISKGMEST
GKWSVVDQIDPKSRDSTYSFLQPLTRLYQNKPYEIVSPKTDTLVMWTSGSSQNDTHKDRP
PEGKIRFDLGEPGPPGTDSTSHLSDTHCQTNGPQKLIEINLIDNQNKNQEVYQSEGCRES
EMKRKTELKGKVATEEEEEEEEEGANSIEDSNSNHGNRNTWEGEIGQPKLSTVDKKGEQS
SKLMTGHENTSKVVIELSPSLPSKRTKIDLFPSLLQNPKSMPELLLLSPAGSGLCLKRQE
IWERPEKPGLEDVELQGTRPELTVTIESKVLENFDTTHLEVEGFASLRNLGDMHANFHNS
QTEQTRRSPTALSEKMSEEISVSSVMCNPSSSSDIEPVPSFSGFPLESPKTLVLNFETEG
AHSSSNSRNGRITSNSLETGHPVENVGHDLGGERTHQALDLLAGGMLSEDVKETSPLQKD
LLRMESTTVSPSGLGPSPCLPDLVDFVTRTPGVPKQKPCSPLSEPDAFLKCSSLEMGSPP
PEILSVSVSEVAVPQVSEDNDSALNLVKTPPSGSPSRDQVVGGNVSPREMPEQEAAVDVI
PDHTRSNVYNSQDYLNG
NT seq 6714 nt   +upstreamnt  +downstreamnt
atgtaccgcagtggctcccgctcctccgtctcttcgcaccggtcgaaagacggcagcgcg
agcggccctccgccgggccgtcccgtgggcgcctcctcaggccccacacgccgcccctcg
tcgccgccgccgccctcttgctcctcgctgcggctccccgcccgccgccaccgctcgccc
tcaggccaccgcggccgctgggcctcgccgtccccgcctcggggtcgtcgcggctccccg
tccccgccccgcggccgccgggcctcaccgtctccgacccgcggccgccgggcctcgcca
tcccctccgcggggtcgtcgtggctccccgtccccgccgcgcgcccgtcgcggctccccg
tcgccaccgcggagccggcgacactacccacctggcctgggtggcttccgaggcagcatt
cgaggcgagtcccgcgccgacttcgcccgggacggccgcggagaccatccaggcggcggc
ggcggcagtcggagacgttctcctggtctgtgttctgattcttctttggaggagagttta
aggatcacagttggcaatgaccacttctgtgttagcacaccagagcggcggcggctcagt
gaccggctgggatctccagtggatggtctgcaggacatggacagggatgacctgactgat
gattctgtcttcactcgaagctcccagtgttctcggggtcttgaacgatacatttctcgg
gaggagggaccacttagtcccttcttgggacaacttgatgaggactaccgaacaagagaa
acttttctgcatcgacctgagtttagtccccagagcagttgtcatgatgaattgttgagg
ggaacagagcggaatagagacaaacttaaaagctcctcctattccatacgatctgaggaa
agaagccgggaggccaaaaggccccgttatgatgacacagagaaggtacacagctcagga
ggggatcactcaagttttacatctgggactcgaaactatcggcagcgaagaagcagccca
agccctaggtttctagatcccgagtttcgagaactggaccttgccaggcgaaagcgagag
gaagaagaggaacaaagtaggagcttgagtcaagagctggtgggtgttggtgatgatcag
attggctgttccatccctggcttggcaggagtcctaaccacatcagagcctggatattct
ttgcagcggcctgaggaagtacctatgatgcccaagaagtccattctgaagaaacgaatt
gaagcggacatgaagccttccttgcagcttgagagcttttctagcggtgccagctctggt
gaagatcaccctctttattctgaacattcacctcttcctctaagtggtgctattgctgct
tttacttcagagattgaaaacaaggggactacagtggaggctgacctgaaagagcctcag
agtaacctataccagtggggccccctccgtgagatacctaaagacaacagtgaaaaattt
gacagttttctaggctttaaggaaaaattggatttgaaggctgagggacttgagcaacag
acagatttcttactgccccatgagagagctagccaggacggcagtggcttttctcgaatt
ctgagcatgttggctgatcctaccattacacaggaaaaaagaagacgtagcttccctgat
attgaggatgaggagaaatttctctatggggatgaagaagaggatataaaatcagaatct
ccacttaagtccctggaggaccccgagagtgcaggtacgagacagaaggcaaactctctg
ccctcaactccagctgtaaagctagaatcactagaagaaagcaatccagaatatgccaag
attcacaacttgcttaagaccatagggctggatattggagtagcagaaattggtaaattg
gctgcacgaacccaggagagacttcatggcaagaagccatcatcacgcccctcagctgac
cgacgtttgtcagctgaccgacacttgtctggtgaccgacacttttcagctgaccgctgt
tcctcagttgagcacagtttcacagctgattggcgctcatcagaccctcacagaccggag
agtagggagacacatcatagcaatactcagtccccagaagtatctcatccacacccagct
tccccggtggatccttacttgcgcaccaaaaatagccctccattcctaaagtctgaccat
ccagtgtgccatgtttcaggaccagaggtagttggcagtgggtttcaatcatctgttgct
gttcggtgcatgttgccatcagccccatctaccccaattagacttcctcactctgctgcg
ttgtctcagtttcatataccaggggcctctcagtttgctgcagctcggatacctccaaat
tatcagggatctgtcattccctctgcctcctttgatgcatataggcactacatggcatat
gcagcctcaaggtggcctatgtatcctgcctctcaaccaccaagccaccctttatctgac
cctcataggctattaccagtaaccaaacaagctgctcgtagtcgtcccaatctccgggtg
atccctactgtgactcctgcaaagcccaaacaagaaataccagtactaggctcaatttct
gtaaagcgaattcctgttcgggtgtccattccatcactcataaaatataatccaaagaag
atctctgatgagaagaaccgtgcctcccagaagcagaaggttattgaagagagagaaaaa
ctgaaaactgaacaggaagcccggcaaaagaaaatgttttatctcacgactgagttggag
cggctccataaacagcaaggggagatgttgcgtaagaagcgaagggagaaggatggtcac
aaagatccacttctgatggaggtgagtcgacttcaggatagtattatgaaggacattgcc
gagctacataaagagacagaagaagcagaaaagaagcagtctgaactggacaaagtggct
cagatcttgggaattgatatctttgataaatccctgaaatcttcaaatgacagtaaagag
tctacagagaagcctgaaaaagaaaaatctaagagcccagaaaaagagttgtcaccctca
aactcttcctctagcaacaaggaatcaaaaatgaatgaaaagtcctgtattaagagccct
agttctactgaaagcctccaaccaactgttaagcagtctgaccagcctgttgctgcttat
gagtattatgatgctggcagtcactggtgcaaagactgcaataccacctgtgggaccatg
tttgacttcttcacccatatgcacaataagaagcacacacagacactggatccctacaac
agaccttgggcttcaaagacccagagtgaggctaagcaagacactgtaaagcgaactgac
aagataactgttcctgcaaaaggctctgagtttctgattcctgtcactgggttttactgc
caactctgtgaggaatttttgggggatccaatttctggagagcagcatgtcaagggtcac
cagcacaacgaaaactacaagaaatatgtggaagaaaacccattgtatgaagaacgaaga
aatctggaccgccaagctggcttggctgtcgttctagagacagagcggcgacggcaaaat
gagctaaaacgcaaacttaatgagaaaccaaaggaggagaagatagaaaaaaaggcaaga
attgtgagagaagtaaaggaagatgacaaagcccctggagaactagaggagcagctctcg
gaggatgggagtgcccctgagaaaggtgaggtgaaggggaacgctagcctcagaccccag
gtgaaagaagaggtaaagaaggagccatcagtagcatcaatagcagcttcttttggaaag
ttcagttggaagaagccagaaaaagaagaagaaaaaggttcagtggtgaccccaggggcc
ccaaaggaagacacggtggaaaccagtaaggacagagatgacggcaaagctgaagttgga
aaggcaaagcccatcaaaatcaagctttctggaaaaactgtcattgcacacaccagtccc
tggacacctgtcgttacgacttcaacacagactaagatccgacccaacttgcctatccca
tccacagtactccgcaagtcaggttcagccacagtgagcaagcctgctcctcttaatacc
tttctgtctatcaagtcctctggaacatccaccaagcctctgccagtggttaaagagtca
tcatcagatcttctcttgcctccagatatcatctccaaagcttttggaggagaagaggtg
gttctaaaagggtctccagaggaaaaagtggaactggctgaaaagaatgagccatcccaa
gtacctgagcaaatgctggctctacttccaccgccaccacctccacctccacccccacct
ccacctccaccccctccaccaccccaggctgtacctcagctatctgccccatcccctgct
caagcaaatgttgtcttaactccagttaaatctaattcggtgatatctcagactttcagt
cttgggttccaaggtcctaacattttgaacccagggttgcctgtggccttcatggcctca
gaacaaccaactgtaattccttctgatgagacagctcctggggtgagtgagagtgactgg
gaccagaccctaatctctatgttagtacggcctccaccacccctttccagtgtattcagt
gaacaggccaaaaaattagaaaagcgaaattcgtgcttagccacagccaatgctaaggac
ctgtatgatatattctacagtagtggtggaaagggggcccatgagactaagctgagtagt
agtacattagccaatggggaaagcagtagccttcctagaacagaaagttcagatttctcc
tccacttgtactttgaacagtagtatgtcctcagaggacctgcctcaatgtagtgctttg
gtcactgctactgaaatcagtaatcttgaaaatcctatttcaaaaggtatggagtccaca
gggaaatggtctgttgtagatcagatagatcccaaaagcagagacagcacctatagcttc
ctacagcctctgacaagattataccaaaataagccttatgaaatagtttccccaaagaca
gacactttggtcatgtggacttctggttcttcccagaatgacactcataaagatagacct
ccagaggggaaaatcagatttgacctgggagagccagggccacctggtacagattcaact
tctcatctatcagatacacactgtcaaaccaacggacctcagaagttgatagaaattaac
ctcatagataaccaaaacaagaaccaagaggtataccagtcagagggttgcagagaaagt
gaaatgaagagaaagactgaattaaaaggaaaggtagcaactgaagaagaagaagaagaa
gaagaagaaggtgccaacagcatagaagattctaattcaaaccatggcaacagaaataca
tgggaaggagaaataggacaacccaagttgtcaacagttgacaaaaagggagaacagtct
agcaaattgatgaccggacatgagaatacaagtaaagtagtaattgaattgagtccgtct
ctcccttccaaaaggacaaaaatagatttatttccgtcattgctccagaatccaaaaagc
atgcctgaactacttctgctgtctccagctggatcaggtttgtgtttaaagagacaagag
atttgggagaggccagaaaaaccaggattggaagatgtggagctacaaggtacccgtcca
gaactaactgtgacaatagaaagcaaagttttggaaaactttgacactacacacttagag
gtagaggggtttgcatctctgaggaatctgggggatatgcatgccaatttccacaatagt
cagacagaacagacacggaggtcaccaactgccctgtcagagaaaatgtctgaagaaatt
tctgtgtcatctgtcatgtgtaatccttccagttccagtgacattgaaccagtaccatct
ttttctggatttccattagaatctcccaaaactttggtgcttaactttgaaacagagggt
gcacatagctcatctaattccagaaatgggagaatcacctctaactctttggaaactgga
caccctgtggaaaatgttggccacgacttaggaggtgagagaacacaccaggcccttgac
ctcttagctggaggaatgttgtctgaggacgtaaaagaaacttcgccactacagaaagat
ttactcagaatggaatccaccacagtcagtccttcaggccttggaccatctccttgcctt
ccagaccttgttgattttgtcacacggacacctggagttccaaaacaaaaaccatgttct
ccactttctgagccagatgcctttctcaagtgtagttcactggagatgggatcaccacct
ccagaaattctgagtgtgtctgtctcagaggtagcagttcctcaagtaagtgaagacaat
gacagtgctttgaatttggtaaaaactccaccctcaggctccccctcaagggatcaggta
gttggaggcaatgtgagccctcgggaaatgcctgaacaagaagctgcagttgatgtcatc
ccagaccacacaaggtccaatgtttataacagtcaggactacttaaatggatga

DBGET integrated database retrieval system