KEGG   Mus musculus (mouse): 57911
Entry
57911             CDS       T01002                                 

Symbol
Gsdma, BB149167, Gsd, Gsdm, Gsdm1, Gsdma1, H312E
Name
(RefSeq) gasdermin A
  KO
K22141  gasdermin-A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    57911 (Gsdma)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   57911 (Gsdma)
SSDB
Motif
Pfam: Gasdermin Gasdermin_C IL31 LANC_like DUF4785
Other DBs
NCBI-GeneID: 57911
NCBI-ProteinID: NP_067322
MGI: 1889509
Ensembl: ENSMUSG00000017204
Vega: OTTMUSG00000006393
UniProt: Q9EST1
Position
11; 11 D
AA seq 446 aa
MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVHTDYTL
LDVLEPGSSPSDPTDSGNFSFKNMLDARVEGDVDVPKTVKVKGTAGLSRSSTLEVQTLSV
APTALENLHKERKLSADHPFLKEMRERGENLYVVMEVVETLQEVTLERAGKAEGCFSLPF
FAPLGLQGSVNHKEAVTIPKGCVLAYRVRQLMVNGKDEWGIPHICNDSMQTFPPGEKPGE
GKFILIQASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDL
EQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQQKLLVKSLEKKIL
PVQLKLVESTMEKNFLQDKEGVFPLQPDLLSSLGEEELILTEALVGLSGLEVQRSGPQYT
WDPDTLPHLCALYAGLSLLQLLSKNS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgactatgtttgagaatgtcacccgggccctggctagacagctgaaccctcgaggggat
ctgacacccctagacagcctcatcgacttcaaacgcttccatcccttctgcctggtgctg
aggaagaggaagagcacactgttctggggagcccgctatgtgcacaccgactacactctc
ctggatgtgctggagccgggcagctccccctcagatccgacagacagtggcaactttagc
tttaagaatatgctggatgctcgagtagagggagatgtggatgtgccaaagacagtgaag
gtaaaggggactgcgggtctgtcacggagcagcacactggaggtgcagacgctcagcgtg
gctcccacggctctggagaacttgcacaaggagaggaaactgtcagcagaccacccattc
ctgaaggagatgcgggaacgcggggagaacctctatgtggtgatggaggtggtggaaacc
ctacaggaagtcactctggagcgagccggcaaggcagagggctgcttctctctccccttc
tttgccccactgggactacagggatccgtgaaccacaaggaggctgtaaccatccccaag
ggctgtgttctggcctatcgagtgagacaactgatggtcaacggcaaagatgagtggggc
attccacacatttgcaatgacagcatgcaaaccttccctcctggagaaaagccaggagaa
gggaagttcatattgatccaggcatctgatgttggggagatgcacgaagacttcaagaca
ttaaaggaagaggttcagcgagagactcaggaagtggagaagttaagtccagtggggcga
agctcactactcacttccctcagccatctcctaggaaagaagaaagagctccaggacctt
gagcagacgcttgaaggggctctagacaagggacacgaagtgaccctggaagcactcccc
aaagatgtcctgctgtcaaaggacgctatggacgccatcctttacttcctcggggctctg
acagtgctaagtgaagcccaacagaagcttctagtaaaatccttggagaaaaagatccta
ccggtgcaactgaagctggttgaaagcaccatggagaagaacttcctgcaagataaagag
ggtgttttccccctgcaacctgatctgctctcctccctcggggaggaggaactgatccta
acagaagcactggtgggactaagcggcctggaagtccagagatcaggcccccagtacacg
tgggatccggacacgctcccccacctttgtgccctctatgctggcctctccctccttcaa
ctgctaagcaagaattcctaa

DBGET integrated database retrieval system