KEGG   Mus musculus (mouse): 58172
Entry
58172             CDS       T01002                                 

Symbol
Sertad2, AB041541, AU021878, Kiaa0127, MNCb-1504, SEI, SEI-2, Se, Sei2, TRIP-Br2, Trip, mKIAA0127
Name
(RefSeq) SERTA domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SERTA
Other DBs
NCBI-GeneID: 58172
NCBI-ProteinID: NP_001033714
MGI: 1931026
Ensembl: ENSMUSG00000049800
Vega: OTTMUSG00000005229
UniProt: Q9JJG5 Q3UGZ1
Position
11; 11 A3.1
AA seq 309 aa
MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQ
KTVLINNMLRRIQEELKQEGSLRPAFTPSSQPSNSLSDSYQEAPPPAPHPCDLGSTTPLE
ACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEKDSFSSALDEIEELCPTSTST
EAAHTAAPEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLTLDD
ILFADIDTSMYDFDPCTSASGTASKMAPVSADDLLKTLAPYSNQPVAPSQPFKMDLTELD
HIMEVLVGS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgttgggtaaaggaggaaaacggaagtttgatgagcatgaagatgggctggaaggcaaa
atcgtgtccccctccgacggtccatccagggtgtcttacaccttacagcgccagactatc
ttcaacatttcccttatgaaactgtataaccacaggcctctgacagagcccagcttgcag
aagactgtcttaattaacaacatgttgaggcggatccaggaggaactcaagcaggaaggc
agcctgaggcctgcattcaccccctcttcccagccgagcaactcactgagcgacagctac
caggaggccccgcctcctgctcctcacccctgtgacctcggaagcactacacccttggag
gcctgcctcacccctgcctccctgctcgaggacgacaacgatgacactttttgcactttg
caggctgtgcaccctgcagctcccactagactctcttctgcagccctcccagcagagaag
gacagcttctcctccgccttggatgagatcgaggagctctgtcccacatctacctccaca
gaggctgcccacacagcagcccctgagggcccgaaaggaacctccagtgagtccagtgtc
cagaaacctgaggggcccgaggaaggccgcacagatgactcacgattcatggactctctg
cctgggaattttgaaataacaacgtccacgggtttcctgacagacttgaccctggatgac
atcttgtttgctgacattgatacatccatgtacgattttgacccctgcacatctgcatcg
gggacagcctcaaagatggcccctgtgtcagctgatgacctcctcaagaccctggctcct
tacagcaatcagcctgttgccccaagtcagcctttcaaaatggatctcacggagctggac
cacatcatggaggtgcttgttggctcctga

DBGET integrated database retrieval system