KEGG   Mus musculus (mouse): 58182
Entry
58182             CDS       T01002                                 

Gene name
Prokr1, EG-VEGFR1, Gpr73, Pk-r1, Pkr1
Definition
(RefSeq) prokineticin receptor 1
  KO
K08379  prokineticin receptor 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    58182 (Prokr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Prokineticin
    58182 (Prokr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 58182
NCBI-ProteinID: NP_067356
MGI: 1929676
Ensembl: ENSMUSG00000049409
Vega: OTTMUSG00000057205
UniProt: Q9JKL1
Position
6; 6 D1
AA seq 393 aa
METTVGALGENTTDTFTDFFSALDGHEAQTGSLPFTFSYGDYDMPLDEEEDVTNSRTFFA
AKIVIGMALVGIMLVCGIGNFIFITALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEM
DYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAA
GLIFLVWSVSILIAIPAAYFTTETVLVIVERQEKIFCGQIWPVDQQFYYRSYFLLVFGLE
FVGPVVAMTLCYARVSRELWFKAVPGFQTEQIRRRLRCRRRTVLGLVCVLSAYVLCWAPF
YGFTIVRDFFPSVFVKEKHYLTAFYVVECIAMSNSMINTLCFVTVRNNTSKYLKRILRLQ
WRASPSGSKASADLDLRTTGIPATEEVDCIRLK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagaccactgtcggggctctgggtgagaataccacagacaccttcaccgacttcttt
tctgcactcgatggccatgaagcccaaaccggctcgttaccattcactttcagctacggt
gactatgacatgcccctggatgaagaggaagatgtgaccaattctcggactttctttgct
gccaagattgtcattggcatggctttggtgggtatcatgctagtgtgtggcatcggcaac
ttcatctttatcactgccctggcccgctacaaaaagctccgcaacctcaccaacctgctt
atcgccaacctggccatttcagacttcctcgtggccatcgtgtgctgcccctttgagatg
gactactatgtggtgcgccagctctcctgggagcatggtcatgtcctgtgcgcctctgtc
aactacttgcgtaccgtctccctctacgtctccactaacgccctactggccattgccatt
gacaggtatctggccattgtgcacccgctgagaccgcggatgaagtgtcaaacagccgcc
ggcctgatcttcctggtgtggtcagtatccatcctcatcgccattccagctgcctacttc
accactgagaccgtgctggtcatcgtggagagacaggagaagatcttctgtggtcagatc
tggccggtggatcagcagttctactacaggtcctatttccttttggttttcggcctcgag
ttcgtgggccctgtagtcgccatgaccttgtgctatgccagggtgtcccgggagctctgg
ttcaaggcggtgccaggcttccagacagagcagatccgccggaggctgcgctgccgccgc
aggactgtgctggggctcgtgtgcgtcctctctgcctatgtgctgtgctgggctcccttc
tatggcttcactatcgtgcgtgacttcttcccctccgtgtttgtgaaggagaagcactac
ctcaccgccttctatgtggtggagtgcatcgccatgagcaacagcatgatcaatacgctc
tgctttgtgactgtcaggaataacaccagtaagtacctcaagaggatcctgcggcttcag
tggagggcctctcccagcgggagcaaggccagcgctgacctcgacctcaggaccacggga
atacctgccaccgaggaggtggactgcatccgactgaaataa

DBGET integrated database retrieval system