KEGG   Mus musculus (mouse): 58185Help
Entry
58185             CDS       T01002                                 

Gene name
Rsad2, 2510004L01Rik, Vig1, cig5
Definition
(RefSeq) radical S-adenosyl methionine domain containing 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05160  Hepatitis C
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    58185 (Rsad2)
   05160 Hepatitis C
    58185 (Rsad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-GeneID: 58185
NCBI-ProteinID: NP_067359
MGI: 1929628
Ensembl: ENSMUSG00000020641
Vega: OTTMUSG00000027569
UniProt: Q8CBB9
Structure
PDB: 

Position
12; 12 A2
AA seq 362 aa AA seqDB search
MGMLVPTALAARLLSLFQQQLGSLWSGLAILFCWLRIALGWLDPGKEQPQVRGEPEDTQE
TQEDGNSTQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLEK
INFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKDYGEYLDILAIS
CDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAFKINSVINRFNVDEDMNEHIKA
LSPVRWKVFQCLLIEGENSGEDALREAERFLISNEEFETFLERHKEVSCLVPESNQKMKD
SYLILDEYMRFLNCTGGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKL
DW
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggggatgctggtgcccactgctctagctgctcggctgctgagcctgttccagcagcag
ctgggttccctctggagtggcctggccatcctgttctgctggctgagaatagcattaggg
tggctagatcccgggaaggaacagccacaggtccggggtgagccggaggacacccaggag
acccaggaagatgggaacagcactcagcccacaacccccgtgagtgtcaactaccacttc
actcgtcagtgcaactacaaatgtggcttctgcttccacacagccaagacatccttcgtg
ctgcccctggaggaggccaagcgaggactgcttctgctcaaacaggctggtttggagaag
atcaacttttctggaggagaacccttccttcaggacaggggtgaatacttgggcaagctt
gtgagattctgcaaggaggagctagccctgccctctgtgagcatagtgagcaatggcagc
cttatccgggagagatggttcaaggactatggggagtatttggacattcttgctatctcc
tgcgacagcttcgatgagcaggttaatgctctgattggccgtggtcaaggaaaaaagaac
catgtggaaaaccttcaaaagctgaggaggtggtgcagggattacaaggtggctttcaag
atcaactctgtcattaatcgcttcaacgtggacgaagacatgaatgaacacatcaaggcc
ctgagccctgtgcgctggaaggttttccagtgcctcctaattgagggtgagaactcagga
gaagatgccctgagggaagcagaaagatttcttataagcaatgaagaatttgaaacattc
ttggagcgtcacaaagaggtgtcctgtttggtgcctgaatctaaccagaagatgaaagac
tcctaccttatcctagatgaatatatgcgctttctgaactgtaccggtggccggaaggac
ccttccaagtctattctggatgttggcgtggaagaagcaataaagttcagtggatttgat
gagaagatgtttctgaagcgtggcggaaagtatgtgtggagtaaagctgacctgaagctg
gactggtga

DBGET integrated database retrieval system