KEGG   Mus musculus (mouse): 58203Help
Entry
58203             CDS       T01002                                 

Gene name
Zbp1, 2010010H03Rik, Dai, Dlm1, mZaDLM
Definition
(RefSeq) Z-DNA binding protein 1
  KO
K12965  Z-DNA binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    58203 (Zbp1)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    58203 (Zbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mmu03019]
    58203 (Zbp1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     58203 (Zbp1)
   mRNA cycle factors
    Stress granule specific factors
     58203 (Zbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: z-alpha HTH_24 HTH_AsnC-type MarR_2 HTH_5 Rrf2
Motif
Other DBs
NCBI-GeneID: 58203
NCBI-ProteinID: NP_001132991
MGI: 1927449
Ensembl: ENSMUSG00000027514
Vega: OTTMUSG00000016683
UniProt: Q9QY24
Structure
PDB: 

Position
2; 2 H3
AA seq 187 aa AA seqDB search
MAEAPVDLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSS
PEPATWSIGGAASGDGAPAIPENSSAQPSLDERILRFLEANGPHRALHIAKALGMTTAKE
VNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIVLPCSPGCPRTHHVDQAGLEPTEIFLL
LPIKFWD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcctgttgacttgagcacaggagacaatctggagcaaaagatcctgcag
gtgttgagcgatgacggcggccctgtgaagattggccagctggtgaagaaatgccaagtg
cccaagaaaaccctcaatcaagtcctttaccgcctgaagaaggaggacagagtgtcctcc
ccagagcctgcaacatggagcataggcggggctgcttctggagatggggctcctgcaatc
cctgagaactccagtgcccagcctagccttgatgaaagaatattaagattcctggaagcc
aatgggcctcacagggccctgcacatcgccaaggctctgggaatgacgacagccaaagaa
gtgaacccactcctgtattccatgagaaataagcaccttctgagctatgacggacagacg
tggaagatctaccactcacgtcaggaaggccaagacatagtcttgccatgtagccctgga
tgtcctagaactcaccatgtagaccaagctggtcttgaacccacagagatcttcttgctt
ctgcctattaaattctgggattaa

DBGET integrated database retrieval system