KEGG   Mus musculus (mouse): 58205Help
Entry
58205             CDS       T01002                                 

Gene name
Pdcd1lg2, B7-DC, Btdc, F730015O22Rik, PD-L2
Definition
(RefSeq) programmed cell death 1 ligand 2
  KO
K06708  programmed cell death 1 ligand 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    58205 (Pdcd1lg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    58205 (Pdcd1lg2)
CD molecules [BR:mmu04090]
 Proteins
  58205 (Pdcd1lg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set ig C2-set_2 V-set C1-set PsbT
Motif
Other DBs
NCBI-GeneID: 58205
NCBI-ProteinID: NP_067371
MGI: 1930125
Ensembl: ENSMUSG00000016498
Vega: OTTMUSG00000014902
UniProt: Q9WUL5 Q3U304
Structure
PDB: 

Position
19; 19 C1
AA seq 247 aa AA seqDB search
MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQ
KVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVK
ASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVL
RLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIV
IIQRKRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgctgccgatactgaacctgagcttacaacttcatcctgtagcagcttta
ttcaccgtgacagcccctaaagaagtgtacaccgtagacgtcggcagcagtgtgagcctg
gagtgcgattttgaccgcagagaatgcactgaactggaagggataagagccagtttgcag
aaggtagaaaatgatacgtctctgcaaagtgaaagagccaccctgctggaggagcagctg
cccctgggaaaggctttgttccacatccctagtgtccaagtgagagattccgggcagtac
cgttgcctggtcatctgcggggccgcctgggactacaagtacctgacggtgaaagtcaaa
gcttcttacatgaggatagacactaggatcctggaggttccaggtacaggggaggtgcag
cttacctgccaggctagaggttatcccctagcagaagtgtcctggcaaaatgtcagtgtt
cctgccaacaccagccacatcaggacccccgaaggcctctaccaggtcaccagtgttctg
cgcctcaagcctcagcctagcagaaacttcagctgcatgttctggaatgctcacatgaag
gagctgacttcagccatcattgaccctctgagtcggatggaacccaaagtccccagaacg
tggccacttcatgttttcatcccggcctgcaccatcgctttgatcttcctggccatagtg
ataatccagagaaagaggatctag

DBGET integrated database retrieval system