KEGG   Mus musculus (mouse): 58214
Entry
58214             CDS       T01002                                 

Symbol
Cst10, DD72
Name
(RefSeq) cystatin 10 (chondrocytes)
  KO
K24380  cystatin-10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    58214 (Cst10)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 58214
NCBI-ProteinID: NP_067380
MGI: 1930004
Ensembl: ENSMUSG00000033156
Vega: OTTMUSG00000015751
UniProt: Q9JM84
Position
2; 2 G3
AA seq 148 aa
MASLLSPSMPVLAAVALTLTLAVIPEASTNAEAKQVVLGGVEPADPKDKEVQKVVKFAVR
TYNDMDNDLYLSKPIRLMSASQQVVAGKNYYLKIELGRTTCTKTESNLVDCPFNEQPDQQ
KRVICNFQINVAPWLNKMSMTNFNCYNF
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcaagtttgctgagcccctcgatgcctgtgttggctgctgtggccttgacactgacc
ctggctgtgatccctgaagccagtactaatgctgaagccaagcaggtggtattaggtgga
gtggagccagctgaccctaaggataaggaggtgcagaaagtggtaaagtttgctgttaga
acctacaatgatatggacaatgacctgtatcttagcaagccaatacgactgatgagcgcc
agccagcaggttgtggctgggaagaactactacttgaaaattgagctaggccgaaccaca
tgtaccaaaactgagtctaatttggttgattgtcccttcaatgaacagccagatcagcag
aagagggtcatctgtaatttccagatcaacgttgcaccttggctgaacaagatgtccatg
acaaacttcaactgttacaatttctga

DBGET integrated database retrieval system