KEGG   Mus musculus (mouse): 58217Help
Entry
58217             CDS       T01002                                 

Gene name
Trem1
Definition
(RefSeq) triggering receptor expressed on myeloid cells 1
  KO
K14362  triggering receptor expressed on myeloid cells 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    58217 (Trem1)
CD molecules [BR:mmu04090]
 Proteins
  58217 (Trem1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 58217
NCBI-ProteinID: NP_067381
MGI: 1930005
Ensembl: ENSMUSG00000042265
Vega: OTTMUSG00000016843
UniProt: Q9JKE2
Structure
PDB: 

Position
17; 17 C
AA seq 230 aa AA seqDB search
MRKAGLWGLLCVFFVSEVKAAIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPD
GKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPN
DPVVLFHPVRLVVTKGSSDVFTPVIIPITRLTERPILITTKYSPSDTTTTRSLPKPTAVV
SSPGLGVTIINGTDADSVSTSSVTISVICGLLSKSLVFIILFIVTKRTFG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggctgggctctggggactgctgtgcgtgttctttgtctcagaagtcaaagct
gccattgttctagaggaagaaaggtatgacctagtggagggccagactttgacagtgaag
tgtcccttcaacatcatgaagtatgccaacagccagaaggcttggcagagactaccagac
gggaaggaacccttgaccctggtggtcacacagaggccctttacaagacccagtgaagtc
cacatggggaagttcaccctgaaacatgaccctagtgaggccatgctacaagttcaaatg
actgaccttcaagtgacagactctggattgtatcgttgtgtgatttaccatcctccgaat
gaccctgttgtgctcttccatcctgtccgcctggtggtgaccaagggttcttcagatgtg
ttcactcctgtcatcattcctattacaaggctgacagagcgtcccatccttattaccaca
aaatactcacccagtgacacaactacaacccgatccctacccaagcccactgcggttgtt
tcctctcctggtcttggagtcactatcataaatgggacagatgctgacagtgtctccaca
tccagtgttactatttcagtcatctgtggacttctcagcaagagcctggttttcatcatc
ttattcattgtcacaaagaggacatttggatga

DBGET integrated database retrieval system