KEGG   Mus musculus (house mouse): 58222
Entry
58222             CDS       T01002                                 
Symbol
Rab37, B230331O03Rik, B230354I04Rik
Name
(RefSeq) RAB37, member RAS oncogene family
  KO
K07914  Ras-related protein Rab-37
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    58222 (Rab37)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    58222 (Rab37)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    58222 (Rab37)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab26/37
    58222 (Rab37)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU DAP3 AAA_25 AAA_16 AAA_24
Other DBs
NCBI-GeneID: 58222
NCBI-ProteinID: NP_067386
MGI: 1929945
Ensembl: ENSMUSG00000020732
UniProt: Q9JKM7 Q544E8
Position
11:114982257..115053066
AA seq 223 aa
MTGTPGAATAGDGEAPERSPPFSPNYDLTGKVMLLGDSGVGKTCFLIQFKDGAFLSGTFI
ATVGIDFRNKVVTVDGARVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNQSSFDN
IRAWLTEIHEYAQRDVVIMLLGNKADVSSERVIRSEDGETLAREYGVPFMETSAKTGMNV
ELAFLAIAKELKYRAGRQPDEPSFQIRDYVESQKKRSSCCSFV
NT seq 672 nt   +upstreamnt  +downstreamnt
atgactggcacaccaggagctgctaccgctggggatggcgaggcccctgagcgctccccg
cccttcagcccgaactacgatctcaccggcaaggtgatgcttcttggagactcgggcgtc
ggcaaaacctgtttcctgatccaattcaaagacggggccttcctgtccggaaccttcata
gccaccgtcggcatagacttcaggaataaagtggtgacagtggatggtgccagggtgaag
cttcagatctgggacactgcaggacaggagcgcttccgcagtgtgacccatgcttattac
cgagatgctcaggctttgctcctgttgtatgacatcaccaaccagtcctcttttgacaac
atcagggcctggctcacagagattcatgagtatgcccagagagacgtggtgattatgctt
ctaggcaacaaggccgatgtaagcagcgaaagggtgatccgttctgaagatggagagaca
ctggccagggaatatggtgttcctttcatggagaccagtgccaagactggcatgaacgtg
gagttggcctttctggcaattgccaaggaactgaaataccgtgcagggaggcagcctgat
gagcccagcttccagatccgagactatgtggagtcccagaagaagcgctccagctgctgc
tcctttgtgtga

DBGET integrated database retrieval system