KEGG   Mus musculus (mouse): 58223Help
Entry
58223             CDS       T01002                                 

Gene name
Mmp19
Definition
(RefSeq) matrix metallopeptidase 19
  KO
K07998  matrix metalloproteinase-19 (RASI) [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    58223 (Mmp19)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     58223 (Mmp19)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   58223 (Mmp19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 DUF4953 Reprolysin_3 Peptidase_M66 Reprolysin_4 Metallopep Astacin
Motif
Other DBs
NCBI-GeneID: 58223
NCBI-ProteinID: NP_067387
MGI: 1927899
Ensembl: ENSMUSG00000025355
UniProt: Q9JHI0 Q2KHP2
Position
10 D3; 10 77.16 cM
AA seq 527 aa AA seqDB search
MDWQQLWLAFLLPMTVSGRALGPTEKEAVLDYLLQYGYLQKPLEGADDFRLEDITEALRT
FQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFNVPST
LSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNTFDGPGKVLAH
ADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQP
FFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGP
RGKTYAFKGDYVWTVTDSGPGPLFQISALWEGLPGNLDAAVYSPRTRRTHFFKGNKVWRY
VDFKMSPGFPMKFNRVEPNLDAALYWPVNQKVFLFKGSGYWQWDELARTDLSRYPKPIKE
LFTGVPDRPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCGSQTPDTNS
STGDVTPSTTDTVLGTTPSTMGSTLDIPSATDSASLSFSANVTLLGA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggactggcagcagctgtggctggcattcttacttcccatgacagtctcaggccgggct
ctggggcctacagagaaggaggcagtcttggattacctgttgcagtatgggtatctacag
aaacctctagaaggagctgatgacttcaggctggaagatatcacagaggctttaagaact
ttccaggaagcatctggactgcccatttccggtcagatggatgacgccacaagggcccgt
atgaagcagccccgttgtggtctggaggatcccttcaaccagaaatctcttaaatacctg
cttctgggccactggagaaagaagaacttgacattccgcatcttcaatgtgccctccacc
ctctcacttcccagagtccgagcagccctgcatcaagcctttaagtactggagcagcgtg
gctcctctgaccttccgggaggtgaaagctggttgggctgacattcgcctctctttccat
ggccgccaaagcctgtactgctccaatacctttgatgggcctggaaaggtcctggcccat
gctgacatcccagaacttgggagtatacactttgataaagatgaactctggactgagggg
acctatcaaggagtgaacctgcgcatcattgcggcccatgaagtgggccatgccctagga
cttgggcactcccgatatacccaggcactcatggctcctgtctatgctggctaccagccc
ttcttcaagctgcatccagatgatgtggcagggatccaggctctctatggcaagaggagc
ccagagacaagagatgaggaggaagagaccgagatgctcactgtgtctccagtgactgca
aaacctggtcccatgccaaacccctgcagcggtgaggtggacgccatggtgctggggcct
cgtgggaagacttatgctttcaagggcgactatgtgtggactgtaacagattcagggcca
ggccccttgttccaaatatctgccctttgggaggggcttcctggaaacctagatgctgcc
gtttactctccccggacacgacggactcatttcttcaagggaaacaaggtgtggcggtat
gtggatttcaagatgtctcctggctttcccatgaaattcaacagagtagagcccaacctg
gatgcagctctctactggcctgttaatcaaaaggtgttcctgtttaagggctcaggatac
tggcaatgggatgaactggccagaactgaccttagccgctaccctaaaccaatcaaggaa
ctgtttactggagtgccagaccgaccctcggcagctatgagctggcaagatggccaagtc
tactttttcaagggcaaagagtattggcgccttaaccagcaacttcgagtggcaaagggc
tatcccagaaatacgacacactggatgcactgtggttctcagactccagacactaactca
tcaaccggggacgttactccttcaaccacagacacagtcttgggtaccactccatcaacc
atgggctcaaccttggacattccctcagctacagactctgcctccctctcattctctgct
aatgtcaccctgctaggggcctga

DBGET integrated database retrieval system