KEGG   Mus musculus (mouse): 58230Help
Entry
58230             CDS       T01002                                 

Gene name
Rnf8, 3830404E21Rik, AIP37, laXp180
Definition
(RefSeq) ring finger protein 8
  KO
K10667  E3 ubiquitin-protein ligase RNF8 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    58230 (Rnf8)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    58230 (Rnf8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     58230 (Rnf8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    58230 (Rnf8)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     58230 (Rnf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA zf-C3HC4 zf-C3HC4_3 zf-C3HC4_2 zf-C3HC4_4 zf-RING_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-rbx1 Yop-YscD_cpl zf-ANAPC11 zf-RING_6 zf-RING_10 CENP-F_leu_zip zf-RING_4 DUF4407 ArsR
Motif
Other DBs
NCBI-GeneID: 58230
NCBI-ProteinID: NP_067394
MGI: 1929069
Ensembl: ENSMUSG00000090083
Vega: OTTMUSG00000034432
UniProt: Q8VC56
Position
17; 17 A3.3
AA seq 488 aa AA seqDB search
MGEPDPLVSGQLAARRSWCLRRLGMDCEWLQLEAGTEVTIGRGLSVTYQLISKVCPLMIS
RSHCVLKQNPEGQWTIMDNKSLNGVWLNRERLAPLQGYCIRKGDHIQLGVPLESRETAEY
EYEVIEEDWESLAPCLAPKNDQRMEKHKGSRTKRKFSSPGLENLPAEGSSDLRCPLANVA
SKPIEPEKLHGKGDASSQSLGCLCPGLTSLKASERAAGPHACSALPKVLELSCPKKQKAC
RPSASQNSLELFKVTMSRMLKLKTQMQEKQIAVLNVKRQTRKGSSKKIVRMEKELRNLQS
QLYAEQAQQQARVEQLEKTFQEEAHYLQGLEKEQGECDLKQQLVQALQEHQALMEELNCS
KKDFEKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMNDLLENELQCIICSEYFIEAVTLN
CAHSFCSFCINEWMKRKVECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIR
ERRAKRLS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcccgaccccttggtctcggggcagctcgcggcccgccggagctggtgcttg
cggcggctggggatggactgcgagtggctgcagctggaggctgggactgaggtgaccata
ggacggggacttagtgtcacataccagctgatatcaaaggtttgccctctgatgatttcc
cgaagccactgtgttctgaagcagaatcctgagggacagtggaccattatggacaataag
agtctgaatggtgtttggctgaacagagaacgtctggcaccattacagggttattgcatc
cgtaagggagaccatatccagctcggtgtgccgctggaaagcagggagacggcggagtat
gaatacgaagtcattgaagaagactgggagagtctggctccctgccttgccccgaagaat
gaccagagaatggaaaaacataaaggctcgagaactaagaggaaattcagttcgcctggg
ttagagaatcttccagccgagggctcctcagatctcagatgcccactggctaatgtcgcc
agtaaacccattgagccagagaagttgcatggcaaaggtgacgcatcgagtcagtccttg
ggatgcttgtgtcctgggctgacttctctgaaggcgagtgagagggccgccgggcctcat
gcttgctctgctcttccaaaggtcctggaactcagttgtcctaagaagcagaaggcctgc
agaccatcagcatctcagaacagcttagaactgtttaaggtgaccatgtccaggatgctg
aagctgaaaacacagatgcaggagaagcagatagctgtcctaaacgtcaagagacagact
cggaaggggagctcaaagaagatcgtgaggatggagaaggagctgcgaaacttacagtct
cagctgtatgcagagcaggctcagcagcaagccagagtggagcagctggagaagactttc
caggaggaggcacattacctccagggtttggagaaagagcaaggagagtgcgacctgaag
caacagctggtgcaggccctgcaggagcatcaggctctaatggaagaactaaattgcagc
aagaaggactttgagaaaatcattcaagccaagaacaaagaattggagcagaccaaggaa
gaaaaggacaaggtgcaagcgcagaaggaggaggttctcagccacatgaacgacttgctg
gagaacgagctccagtgcattatctgctcggagtactttattgaggctgtcaccctgaac
tgtgcccacagtttctgctccttctgtatcaatgaatggatgaaacggaaagtagagtgt
cccatttgtcgaaaggacattgagtccagaaccaactccctggttctggacaactgcatt
agtaagatggtggataacctaagctcagacgtgaaggaaagaagaagtgtccttattagg
gaacggagagcaaagagactgtcatga

DBGET integrated database retrieval system