KEGG   Mus musculus (house mouse): 58233
Entry
58233             CDS       T01002                                 
Symbol
Dnaja4, 1110021L12Rik, AV358213, Dj4, Hsj4, mmDjA4
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member A4
  KO
K09505  DnaJ homolog subfamily A member 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    58233 (Dnaja4)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   58233 (Dnaja4)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Other DBs
NCBI-GeneID: 58233
NCBI-ProteinID: NP_067397
MGI: 1927638
Ensembl: ENSMUSG00000032285
UniProt: Q9JMC3
Position
9:54606132..54623601
AA seq 397 aa
MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKK
RDIYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLY
NGITKKLALQKNVICEKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIGPGMVQQIQTVCIE
CKGQGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHGEGDQEPELDPGDV
IIVLDQKDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLVISSKSGEVIKHGD
LKCIRNEGMPIYKAPLEKGVMIIQFLVVFPEKQWLSQEKLPQLEALLPPRQKVRITDDMD
QVELKEFNPNEQSWRQHREAYEEDDEEPRAGVQCQTA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggtgaaggagacccagtactatgacatcctgggggtgaagcccagcgcgtccccggag
gagatcaagaaggcctatcggaagctggcgctcaagtaccacccggacaagaacccggat
gagggcgagaagtttaaacttatatcccaggcatatgaagtactttcagatcctaagaaa
agagacatctatgaccaaggtggagaacaggcaattaaagaagggggatcgggcagcccc
agcttctcttcacccatggatatctttgatatgttctttggtggtggaggacggatgact
agagagagaagaggcaagaatgttgtccaccagctgtcagtaactctggaagacttatat
aatggaatcactaagaaactggccctccagaaaaatgtaatttgtgagaaatgtgaaggc
atcggtgggaaaaaggggtctgtggagaagtgccccctgtgcaaggggcgggggatgcag
gtccacatccagcagattgggccgggcatggtgcagcagatccagactgtgtgcatcgag
tgcaagggccagggcgagcgcatcaaccccaaggaccgctgtgagaactgcagcggagcc
aaggttacccgagagaagaagatcattgaggtgcacgtggagaaaggtatgaaggatggg
caaaagatactgtttcatggagaaggagatcaggagcctgagctggaccctggcgatgtg
ataattgtgcttgatcagaaggatcatagtgtctttcagagacgaggccaggatctgatc
atgaaaatgaaaattcagctctctgaagctctttgtggcttcaagaagacaataaaaacg
ctggatgatcgagtccttgtcatttcatctaagtcaggtgaggtgataaagcatggggac
ctgaagtgtatccgcaacgaggggatgcccatctacaaagcccccctggagaagggggtg
atgatcatacagtttttagtagtcttccctgaaaaacagtggctctctcaggagaagctt
cctcagctggaggctctgcttccccctcggcagaaggtgaggatcacagatgacatggat
caggtggagttgaaggagttcaatcccaacgagcagagctggcgccagcacagggaggcc
tatgaggaagatgacgaagagccccgcgctggcgtgcagtgccagacggcatga

DBGET integrated database retrieval system