KEGG   Mus musculus (mouse): 58251
Entry
58251             CDS       T01002                                 

Symbol
Cep295nl, Ddc8, FS39, Kiaa1731nl
Name
(RefSeq) CEP295 N-terminal like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GHL13 NAD_binding_9
Other DBs
NCBI-GeneID: 58251
NCBI-ProteinID: NP_067415
MGI: 1929713
Ensembl: ENSMUSG00000076433
Vega: OTTMUSG00000003878
UniProt: Q497N6
Position
11; 11 E2
AA seq 533 aa
MQRDTERAAQLSPSSEDEALVLRQKPLEMPAQEEDSTTLQQWKARQLQRLAEELKAEWQE
ARLQQVRQAERLYLSHLLDEAAERSMGNDPSVHEQNQRRTAKHTRAKERNRAAFREERGR
REEHPRQHPKSRKKAPCSERRSSAKARGPASGEKGKRRRVSSSKDHDGYQGPRVTRRVGV
AKLNPFFDGDTDCMEDVQKEFFREGRRPSAKGTHNLRDQSLQGKTTALTQPLLHGPTCKQ
EAAAQEPPSKYNKNLWHKEIESTFEELFNMNRKLKKHLNLHLEQRLKADQNPDEQQSYSE
IRSETFGTPREERTEEVETAEESGSPTEVETTEMWSKVNLKQILSDSEYPRYQQIAKYPL
KSESLVPVKAGTSREQDDLLSLSPESGQEPPKSPLLEDESLKPYLQKQADSVASWMALRQ
KQKAELEQRRQKALLELTEHPNMSLEIHYKAELEEERRARRRMRLALLKSNSTGICALPP
DRNNLSLDNGLLDEDKQNQMIRDLQQQILEQNKLHQEFLEKARKRLQEFQKSF
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgcagagagacacggagcgagcagctcagctgagcccttcttccgaagatgaagcctta
gttttgaggcagaagccgttagagatgccagcccaagaggaggacagtaccactctgcag
cagtggaaagcacggcagctgcaacgcctggctgaggagttaaaggcagagtggcaggag
gcccggctgcagcaggtccgacaggctgaacgcctctacttatcccacctgttggacgag
gcagccgagcggagcatgggaaacgatcccagcgtgcatgaacagaaccagagaagaaca
gcaaaacacacaagggctaaagagagaaaccgagcagctttcagagaggagcggggccgc
agggaggagcaccccaggcagcaccccaagtcccggaaaaaggcaccatgctcagagaga
cgcagttctgccaaagcccggggcccagcctccggtgagaagggtaaaaggagacgggtg
tcttcaagtaaggaccacgatggctaccagggccctcgggtgaccagaagggtaggtgtg
gcaaagctcaacccattctttgatggagacactgactgcatggaggacgtgcagaaggaa
ttcttccgggaggggaggcggccctcggcaaaggggactcacaacctcagggaccagagt
ctacagggcaaaacaacagccctaactcagcccttgctccacggccccacctgcaaacaa
gaggctgcagcccaggagcccccaagcaagtacaacaagaatctgtggcacaaagaaatc
gaatctacctttgaagaattgtttaacatgaataggaagctgaagaaacatttgaatttg
cacctggaacagaggctcaaggcagaccagaatccagatgagcagcagagctactcagag
attcggagtgagacctttggcaccccgagagaggagaggacggaggaggtagaaaccgcc
gaggagtctgggagcccaaccgaggtggagaccactgagatgtggtccaaagtcaatctg
aaacagatactgagtgactcagagtaccccagataccagcagatagcaaagtacccgtta
aagagtgaaagcctagtgcctgtcaaggcagggacatctagagaacaagatgacttactc
tcactaagcccagagtcaggacaggagccgcccaagtcacctttgttggaggacgaaagc
ctcaagccttacctgcagaaacaggcagactctgtagcaagctggatggctttgaggcaa
aagcagaaggcagagttggagcagagaaggcaaaaggcacttttggagctgacagaacac
cccaacatgagcttggagatccactacaaggctgagctggaggaagaacgccgggcgcgt
agacggatgcgcttggctctcctcaaatctaattccactgggatctgtgccctgccccct
gaccgaaacaacctgtccctggacaacggccttctcgatgaggacaaacagaaccagatg
attcgtgacctccagcagcagatcttagagcaaaacaagttacaccaggagtttttggaa
aaagccaggaaacgcttgcaagagtttcaaaaatcattttaa

DBGET integrated database retrieval system