KEGG   Mus musculus (house mouse): 58520
Entry
58520             CDS       T01002                                 
Symbol
Erg28, 0610007P14Rik, 1190004E09Rik, AU019315, C77855, ORF11
Name
(RefSeq) ergosterol biosynthesis 28
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Erg28 Bax1-I
Other DBs
NCBI-GeneID: 58520
NCBI-ProteinID: NP_067421
MGI: 1915571
Ensembl: ENSMUSG00000021252
UniProt: Q9ERY9
Position
12:complement(85862221..85871667)
AA seq 140 aa
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS
SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVFGTAAPTVGVLAPLMVASFSILG
MLVGLRYLEAEPVSRQKKRN
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagccgcttcctgaatgtgttacgaagctggctggttatggtgtccattatagccatg
gggaacacactccagagcttccgagaccacacttttctctacgagaagctctacactggc
aagccaaaccttgtgaatggcctccaagcccggacctttgggatctggacgctgctctca
tcagtgattcgctgcctctgtgccattgacatccacaacaaaacactctatcacatcaca
ctgtggacattcctcctcgccctgggacacttcctctcagagttgtttgtatttggaaca
gcagctcccacagttggtgtgctggcacccctgatggtagcaagtttctcaatcctgggc
atgctggtcgggctccggtacctagaggcagaaccagtatccagacagaagaaaagaaat
tga

DBGET integrated database retrieval system