KEGG   Mus musculus (mouse): 58799Help
Entry
58799             CDS       T01002                                 

Gene name
Crbn, 2610203G15Rik, 2900045O07Rik, AF229032, AW108261, piL
Definition
(RefSeq) cereblon
  KO
K11793  cereblon
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    58799 (Crbn)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     58799 (Crbn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LON_substr_bdg Yippee-Mis18 Baculo_ME53
Motif
Other DBs
NCBI-GeneID: 58799
NCBI-ProteinID: NP_780566
MGI: 1913277
Ensembl: ENSMUSG00000005362
Vega: OTTMUSG00000023530
UniProt: Q8C7D2
Structure
PDB: 

Position
6; 6 E1
AA seq 445 aa AA seqDB search
MAGEGDQQDAAHNMGNHLPLLPADSEDEDDEIEMEVEDQDSKEARKPNIINFDTSLPTSH
TYLGADMEEFHGRTLHDDDSCQVIPVLPEVLMILIPGQTLPLQLSHPQEVSMVRNLIQKD
RTFAVLAYSNVQEREAQFGTTAEIYAYREEQEFGIEVVKVKAIGRQRFKVLELRTQSDGI
QQAKVQILPECVLPSTMSAVQLESLNKCQVFPSKPISWEDQYSCKWWQKYQKRKFHCANL
TSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPENPIDFSYRVAACLPIDDVLRIQ
LLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVH
ETLTVYKASNLNLIGRPSTVHSWFPGYAWTIAQCKICASHIGWKFTATKKDMSPQKFWGL
TRSALLPTIPETEDEISPDKVILCL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgagggagatcagcaggacgctgcgcacaacatgggaaaccacctgccgctt
ctgcctgcagacagtgaagatgaagatgatgaaattgaaatggaagttgaagaccaagat
agtaaagaagccagaaaaccgaatatcataaactttgacaccagtctgccaacctcacat
acatacctgggagctgatatggaggagttccacgggagaactttgcatgacgacgacagc
tgccaggtgatcccagtccttcctgaggtgctgatgatcctgattcctgggcagacactc
ccactgcagctctctcacccacaggaagtcagcatggtgcggaacttaatccagaaagac
aggacctttgcagtccttgcatacagtaatgtgcaagaaagggaagcacagtttgggaca
acagcagagatctatgcctatcgagaagagcaggagtttggaattgaagtagtgaaagtg
aaagcaattggaaggcagcggttcaaggtcctcgaacttcgaacacagtcagatggaatc
cagcaagctaaagtgcagattttgccagagtgtgtgttgccgtcaaccatgtctgcagtg
cagttagaatcactcaataagtgccaggtatttccttcaaaacccatctcctgggaagac
cagtattcatgtaaatggtggcagaaataccagaagagaaagtttcactgtgcaaatcta
acatcatggcctcgctggctgtattcattatatgatgctgaaacattaatggatagaatt
aagaaacagctacgtgaatgggatgaaaatctcaaagatgattctcttcctgaaaatcca
atagacttttcttacagagtagctgcttgtcttcctattgatgatgtattgagaattcag
ctccttaaaatcggcagtgctattcaacggcttcgctgtgaattggacatcatgaacaaa
tgtacttccctttgctgtaaacaatgtcaagaaacagaaataacgacaaagaatgaaata
tttagtttatccttatgtggtccaatggcagcatatgtgaatcctcatggatatgtacat
gagacactgactgtgtataaagcgtccaacctgaatctgataggccggccttctacagtg
cacagctggtttcccgggtatgcatggaccattgcccagtgcaagatctgtgcaagccat
attggatggaaatttacagccacaaaaaaagacatgtcacctcaaaaattttggggctta
actcgctctgctctgttacccacaattccagagactgaagatgaaataagtccagacaaa
gtaatactttgtttataa

DBGET integrated database retrieval system