KEGG   Mus musculus (mouse): 58859
Entry
58859             CDS       T01002                                 

Symbol
Efemp2, 0610011K11Rik, Fbln4, MBP1
Name
(RefSeq) epidermal growth factor-containing fibulin-like extracellular matrix protein 2
  KO
K19866  EGF-containing fibulin-like extracellular matrix protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    58859 (Efemp2)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    58859 (Efemp2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   58859 (Efemp2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   58859 (Efemp2)
SSDB
Motif
Pfam: EGF_CA cEGF FXa_inhibition EGF_3 EGF hEGF
Other DBs
NCBI-GeneID: 58859
NCBI-ProteinID: NP_067449
MGI: 1891209
Ensembl: ENSMUSG00000024909
Vega: OTTMUSG00000036759
UniProt: Q9WVJ9 Q542X5
Position
19; 19 A
AA seq 443 aa
MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEWDADSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQES
CVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCNQGYELHRDGFS
CSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECETGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADV
FQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctcccttttgcctcctgcctccccgggtctttgctgctctgggcgtttctgctgttg
ctcttgggagcagcgtccccacaggatcccgaggagccggacagctacacggaatgcaca
gatggctatgagtgggatgcagacagccagcactgccgggatgtcaacgagtgcctgacc
atcccggaggcttgcaagggtgagatgaaatgcatcaaccactacgggggttatttgtgt
ctgcctcgctctgctgccgtcatcagtgatctccatggtgaaggacctccaccgccagcg
gcccatgctcaacaaccaaacccttgcccgcagggctacgagcctgatgaacaggagagc
tgtgtggatgtggacgagtgtacccaggctttgcatgactgtcgccctagtcaggactgc
cataaccttcctggctcctaccagtgcacctgccctgatggttaccgaaaaattggaccc
gaatgtgtggacatagatgagtgtcgttaccgctattgccagcatcgatgtgtgaacctg
ccgggctcttttcgatgccagtgtgagccaggcttccagttgggacctaacaaccgctct
tgtgtggatgtgaatgagtgtgacatgggagccccatgtgagcagcgctgcttcaactcc
tatgggaccttcctgtgtcgctgtaaccagggctatgagctgcaccgggatggcttctcc
tgcagcgatatcgatgagtgcggctactccagttacctctgccagtaccgctgtgtcaac
gagccaggccgattctcctgtcactgcccacaaggctaccagctgctggctacaaggctc
tgccaagatattgacgagtgtgaaacaggtgcacaccaatgttctgaggcccaaacctgt
gtcaacttccatgggggttaccgctgtgtggacaccaaccgttgtgtggagccctatgtc
caagtgtcagacaaccgctgcctctgccctgcctccaatcccctttgtcgagagcagcct
tcatccattgtgcaccgctacatgagcatcacctcagagcgaagtgtgcctgctgacgtg
tttcagatccaggcaacctctgtctaccctggtgcctacaatgcctttcagatccgttct
ggaaacacacagggggacttctacattaggcaaatcaacaatgtcagcgccatgctggtc
ctcgccaggccagtgacgggaccccgggagtacgtgctggacctggagatggtcaccatg
aattcccttatgagctaccgggccagctctgtactgagactcacggtctttgtgggagcc
tataccttctga

DBGET integrated database retrieval system