KEGG   Mus musculus (mouse): 58861Help
Entry
58861             CDS       T01002                                 

Gene name
Cysltr1, BB147369, CysLT1R, Cyslt1
Definition
(RefSeq) cysteinyl leukotriene receptor 1
  KO
K04322  cysteinyl leukotriene receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    58861 (Cysltr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    58861 (Cysltr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    58861 (Cysltr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    58861 (Cysltr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 58861
NCBI-ProteinID: NP_001268788
MGI: 1926218
Ensembl: ENSMUSG00000052821
Vega: OTTMUSG00000018272
UniProt: Q99JA4
Position
X; X D
AA seq 352 aa AA seqDB search
MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVL
YVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYV
NLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQ
DEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNM
PSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAA
SNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtacctccaaggcaccaagcagacattcctggagaacatgaatggaactgaaaatctg
acgacatctctcattaataacacgtgtcatgacacaattgatgaattccgaaatcaagta
tactccactatgtattctgtgatctctgttgtgggtttctttggcaatagctttgtgctc
tatgtcctcataaaaacataccatgagaaatcagccttccaagtatacatgattaatcta
gccatagcagatctactctgtgtatgtacattgcctctccgtgtggtctattatgttcac
aaaggcaagtggctctttggtgactttttgtgccgcctcaccacctatgccttgtacgtt
aacctctattgtagcatcttctttatgacagccatgagctttttccggtgtgttgcaatt
gtctttccagtccagaacattaatttggttacacagaaaaaagccaggttcgtttgcatt
ggaatttggatttttgtgattttgacaagttctccctttttaatgtacaaatcttaccaa
gatgagaaaaacaatactaaatgctttgagcctccacagaacaatcaagctaaaaaatac
gttttgatcttgcattatgtgtcattattctttggtttcatcatcccttttgtcaccata
attgtctgttacacaatgatcattctgaccttactaaaaaatacaatgaagaaaaacatg
ccaagtcgtaggaaggctatagggatgatcatagttgtgacagctgcctttttagtgagc
ttcatgccatatcatattcaacgaactatccaccttcaccttttacacagtgaaactaga
ccctgtgattctgtccttaggatgcagaagtcagtggtcataaccttatctctagctgca
tcaaattgttgctttgatcctctgctatatttcttttcaggtggaaactttaggagaagg
ctatctacatttagaaagcattctttgtccagtatgacttatgtacccaagaagaaagct
tccttgccagaaaaaggagaagaaatatgtaacgaataa

DBGET integrated database retrieval system