KEGG   Mus musculus (mouse): 58864
Entry
58864             CDS       T01002                                 

Gene name
Tssk3, 1700014N07Rik, 4930594I21Rik, Stk22c, Stk22d, Tsk-3, Tssk-3, Tssk3b
Definition
(RefSeq) testis-specific serine kinase 3
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    58864 (Tssk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    58864 (Tssk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     58864 (Tssk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   58864 (Tssk3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    58864 (Tssk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo Rdx
Other DBs
NCBI-GeneID: 58864
NCBI-ProteinID: NP_536690
MGI: 1929914
Ensembl: ENSMUSG00000000411
Vega: OTTMUSG00000009663
UniProt: Q9D2E1
Position
4; 4 D2.2
AA seq 268 aa
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKIIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKIYLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSRRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLGISTECQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
NT seq 807 nt   +upstreamnt  +downstreamnt
atggaggactttctactctccaatgggtatcagctgggcaagaccattggggaagggacc
tactcaaaagtcaaagaagcattttccaaaaaacatcaaagaaaagtggcaattaaaatt
atagacaagatgggagggccagaagagtttatccagagattcctgcctcgtgagctccag
attgtccgtaccctggaccacaaaaacatcatccaggtgtatgagatgctggagtcagca
gatggaaaaatctacctggtgatggaactggctgagggaggggatgtctttgactgtgtg
ctgaacggagggccacttcccgagagccgggccaaggccctcttccgccagatggttgag
gctattcgctattgccatggctgtggcgtggcccaccgggaccttaagtgtgagaacgcc
ttgttgcagggcttcaacctgaagctgaccgactttggctttgccaaggtgctacccaag
tcacgcagggagctgagccagaccttctgtggcagcacagcctatgccgcccctgaggtg
ctacagggcataccccatgatagcaagaaaggtgatgtctggagcatgggtgtggtcctg
tatgtaatgctctgtgcaagtctaccttttgatgacacagatatccccaagatgctgtgg
cagcagcagaagggggtgtccttccccactcatttgggcatctcaaccgaatgccaggac
ctgctcaagcggctcctggaaccagacatgatactccggccttcaatcgaagaagttagt
tggcacccatggctagcaagcacttga

DBGET integrated database retrieval system