KEGG   Mus musculus (mouse): 58866
Entry
58866             CDS       T01002                                 

Gene name
Treh, 2210412M19Rik
Definition
(RefSeq) trehalase (brush-border membrane glycoprotein)
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    58866 (Treh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    58866 (Treh)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     58866 (Treh)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  58866 (Treh)
SSDB
Motif
Pfam: Trehalase Glyco_hydro_63 GDE_C
Other DBs
NCBI-GeneID: 58866
NCBI-ProteinID: NP_067456
MGI: 1926230
Ensembl: ENSMUSG00000032098
Vega: OTTMUSG00000033497
UniProt: Q9JLT2
Position
9; 9 A5.2
AA seq 576 aa
MTWELHLLLLLGLGLRSQEALPPPCESQIYCHGELLHQVQMAQLYQDDKQFVDMSLATSP
DEVLQKFSELATVHNHSIPKEQLQEFVQSHFQPVGQELQSWTPEDWKDSPQFLQKISDAN
LRVWAEELHKIWKKLGKKMKAEVLSYPERSSLIYSKHPFIVPGGRFVEFYYWDSYWVMEG
LLLSEMASTVKGMLQNFLDLVKTYGHIPNGGRIYYLQRSQPPLLTLMMDRYVAHTKDVAF
LQENIGTLASELDFWTVNRTVSVVSGGQSYVLNRYYVPYGGPRPESYRKDAELANSVPEG
DRETLWAELKAGAESGWDFSSRWLVGGPDPDLLSSIRTSKMVPADLNAFLCQAEELMSNF
YSRLGNDTEATKYRNLRAQRLAAMEAVLWDEQKGAWFDYDLEKGKKNLEFYPSNLSPLWA
GCFSDPSVADKALKYLEDSKILTYQYGIPTSLRNTGQQWDFPNAWAPLQDLVIRGLAKSA
SPRTQEVAFQLAQNWIKTNFKVYSQKSAMFEKYDISNGGHPGGGGEYEVQEGFGWTNGLA
LMLLDRYGDQLTSGTQLASLGPHCLVAALLLSLLLQ
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgacctgggagctgcacctgctgcttctgctggggctgggacttaggtcccaggaggcc
ctgccaccaccctgtgagagccagatctactgccatggagagctcctgcaccaagttcag
atggcccagctctaccaagatgacaagcagtttgtggatatgtcactggccacatctcca
gatgaagtcctgcagaagttcagtgagctggccacagtccacaaccacagcatccccaag
gaacagcttcaggaatttgtccagagtcacttccagcccgtggggcaggagctgcagtcc
tggacccctgaggactggaaggacagccctcagttcctgcagaagatctcggatgctaat
ctgcgtgtctgggcggaggagctacacaagatctggaaaaagctgggaaagaagatgaaa
gcagaagtcctcagctaccccgagaggtcctccctaatctactcaaagcaccccttcatt
gtgcccggggggcgctttgttgaattctactactgggactcgtactgggtgatggaaggc
ctgcttctttctgagatggcctcaacagtgaagggtatgctgcaaaactttctggatctg
gtgaagacctacggacatatccccaacggtggacgcatatattacctgcaacggagccag
cccccactcctgactctcatgatggatcgatatgtagctcataccaaggatgtcgccttc
cttcaggagaatattgggactctagcctctgaactggacttctggactgtgaacaggact
gtctctgtagtctcaggaggacaaagctatgtcttaaatcgctactatgtcccttatggg
ggacccaggccagagtcctacaggaaagacgcagaattggcaaactctgtgccagaaggg
gaccgagagactctgtgggctgagctcaaggctggggctgagtctggctgggacttctct
tcacgctggcttgttggaggcccagaccctgatttgctcagcagcatccgaaccagcaaa
atggtacccgctgatctgaacgcgttcctgtgccaagcagaggaactgatgagtaacttc
tactccagactagggaacgacacagaggccacaaagtacaggaacctgcgggcccagcgc
ttggccgccatggaagctgtcctgtgggacgagcagaagggtgcctggtttgactatgac
ttggaaaaggggaagaagaacctggagttttatccctccaacctctccccactttgggct
ggctgcttctcagaccctagtgttgctgacaaggctctgaagtacttggaggacagcaag
atcttgacctaccaatatggaatcccaacctctcttcgtaacacaggccagcagtgggac
ttccccaatgcctgggccccactgcaggacctggtcattagaggtttggccaagtcagct
tccccccggactcaggaggtggctttccagctggcccagaattggatcaaaaccaacttc
aaagtctactcccaaaagtcagcgatgtttgagaagtatgacatcagcaacggtggacat
ccaggtggaggaggggagtatgaagttcaggaaggatttggctggacaaacggattggcc
ctgatgcttctggatcgctatggtgaccagttgacttcagggacccagttagcttccctg
ggaccccactgcctagtggctgcccttcttctcagtcttctgctacagtga

DBGET integrated database retrieval system