KEGG   Mus musculus (house mouse): 58875
Entry
58875             CDS       T01002                                 
Symbol
Hibadh, 6430402H10Rik
Name
(RefSeq) 3-hydroxyisobutyrate dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    58875 (Hibadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     58875 (Hibadh)
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored IlvN 3HCDH_N DpaA_N TrkA_N
Other DBs
NCBI-GeneID: 58875
NCBI-ProteinID: NP_663542
MGI: 1889802
Ensembl: ENSMUSG00000029776
UniProt: Q99L13
Position
6:complement(52523215..52617285)
AA seq 335 aa
MAASLGFRGAASGLWYWSGRRRPVGSLAAVCSRSMASKTPVGFIGLGNMGNPMAKNLMKH
GYPLILYDVFPDVCKEFKEAGEQVASSPAEVAEKADRIITMLPSSMNAVEVYSGANGILK
KVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDE
FAAAQELLECMGSNVVYCGAVGTGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDPKLLA
KILNMSSGRCWSSDTYNPVPGVMHGVPSSNNYQGGFGTTLMAKDLGLAQDSATSTKTPIL
LGSLAHQIYRMMCSKGYSKKDFSSVFQYLREEEPF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcagcctccttggggttccggggagcagcctccggcctctggtactggagcggccgg
cggcggcccgtgggcagccttgcagcggtgtgttctaggtcaatggcttctaagactcca
gttggattcattggactgggaaacatgggaaatccaatggcaaaaaatctcatgaaacat
ggctatccactcatcctctatgacgtgttccctgatgtatgcaaggagtttaaagaggct
ggggaacaggtagcatcctccccagcagaagtagccgaaaaggctgacaggattatcaca
atgctgccctccagtatgaatgcggtagaagtttattctggagcaaacgggattctaaaa
aaagtgaagaaaggctcattattaatagattccagtactattgatccttcagtttcaaaa
gaattggcaaaagaagttgagaaaatgggagctgttttcatggacgcccctgtctccggt
ggtgtaggagctgctcggtctggaaaccttacatttatggtgggaggagttgaagatgag
tttgctgctgcccaagagttgctggaatgcatgggctccaacgtggtatactgtggagct
gttggaacggggcagtctgcaaagatctgcaacaacatgctgttggctataagtatgatt
ggaaccgctgaagctatgaaccttggaatcaggtcaggccttgacccaaaactattggct
aaaatcctgaatatgagctccggacgatgctggtccagcgacacttacaaccccgtaccc
ggggttatgcatggggtcccctcatccaataactaccaaggtggatttggaacaacacta
atggctaaggatctgggattggctcaagactctgccaccagcaccaagaccccaattctc
ctaggaagcctggcccatcagatatacaggatgatgtgttcaaagggctactcaaagaaa
gacttctcatctgtgttccagtatctacgggaggaggagcccttctga

DBGET integrated database retrieval system