KEGG   Mus musculus (mouse): 58991
Entry
58991             CDS       T01002                                 

Gene name
Ghrl, 2210006E23Rik, Ghr, MTLRP, MTLRPAP, m46
Definition
(RefSeq) ghrelin
  KO
K05254  ghrelin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    58991 (Ghrl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    58991 (Ghrl)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    58991 (Ghrl)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 58991
NCBI-ProteinID: NP_067463
MGI: 1930008
Ensembl: ENSMUSG00000064177
Vega: OTTMUSG00000056499
UniProt: Q9EQX0 A2RSS9
Position
6 E3; 6 52.84 cM
AA seq 117 aa
MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPE
DRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgctgtcttcaggcaccatctgcagtttgctgctactcagcatgctctggatggacatg
gccatggcaggctccagcttcctgagcccagagcaccagaaagcccagcagagaaaggaa
tccaagaagccaccagctaaactgcagccacgagctctggaaggctggctccacccagag
gacagaggacaagcagaagagacagaggaggagctggagatcaggttcaatgctcccttc
gatgttggcatcaagctgtcaggagctcagtatcagcagcatggccgggccctggggaag
tttcttcaggatatcctctgggaagaggtcaaagaggcgccagctgacaagtaa

DBGET integrated database retrieval system