KEGG   Mus musculus (mouse): 58992
Entry
58992             CDS       T01002                                 

Gene name
F12, FX, FXII, HAF
Definition
(RefSeq) coagulation factor XII (Hageman factor)
  KO
K01328  coagulation factor XII (Hageman factor) [EC:3.4.21.38]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    58992 (F12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    58992 (F12)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    58992 (F12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.38  coagulation factor XIIa
     58992 (F12)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   58992 (F12)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   58992 (F12)
SSDB
Motif
Pfam: Trypsin Kringle fn2 EGF fn1 Trypsin_2 EGF_2 hEGF DUF1986
Other DBs
NCBI-GeneID: 58992
NCBI-ProteinID: NP_067464
MGI: 1891012
Ensembl: ENSMUSG00000021492
Vega: OTTMUSG00000035495
UniProt: Q80YC5
Position
13; 13 B1
AA seq 597 aa
MTALLFLGSLLMSLDLTLSAPPWKDSKKFKDAPDGPTVVLTVDGRLCHFPFQYHRQLHHK
CIHKRRPGSRPWCATTPNFDEDQQWGYCLEPKKVKDHCSKHNPCHKGGTCINTPNGPHCL
CPEHLTGKHCQKEKCFEPQLLKFFHENELWFRTGPGGVARCECKGSEAHCKPVASQACSI
NPCLNGGSCLLVEDHPLCRCPTGYTGYFCDLDLWATCYEGRGLSYRGQAGTTQSGAPCQR
WTVEATYRNMTEKQALSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWDYCGLEQCQTPTF
APLVVPESQEESPSQAPSLSHAPNDSTDHQTSLSKTNTMGCGQRFRKGLSSFMRVVGGLV
ALPGSHPYIAALYWGNNFCAGSLIAPCWVLTAAHCLQNRPAPEELTVVLGQDRHNQSCEW
CQTLAVRSYRLHEGFSSITYQHDLALLRLQESKTNSCAILSPHVQPVCLPSGAAPPSETV
LCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNSNVHGDAILPGMLCAGFLEGGTDA
CQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKHIAS
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacggctctgttgttcctggggtctctgctgatgagtctggatctgacactttcggct
ccaccatggaaagactccaagaaatttaaggacgcacctgatgggcccacagtggttctc
actgtggatgggaggctctgccattttccctttcagtaccaccgtcagctacaccacaaa
tgcatccacaaaaggcggccaggctcccgcccctggtgtgctaccacccccaactttgat
gaagatcagcaatggggatactgcttggagcccaagaaagtgaaagaccattgcagcaaa
cacaacccgtgccacaaaggagggacatgtatcaacacccccaatgggccacactgtctc
tgccctgaacacctcactgggaaacattgccagaaagagaaatgctttgagcctcagctt
ctcaagttcttccacgagaatgagctatggtttagaacggggccaggaggtgtggccagg
tgcgagtgcaaaggttctgaggctcactgcaagccggtggccagccaggcctgcagcatc
aatccgtgccttaatgggggcagctgcctcctcgtggaggaccacccactgtgccgttgc
cctacaggctacactggatatttttgcgacttggacctttgggcgacctgctatgaaggc
agggggctcagctaccggggccaggctggaactacgcaatcgggtgcgccatgtcagcgg
tggaccgtggaggccacctaccggaacatgactgagaagcaagcgctaagctggggcctg
ggccaccacgcattttgccggaacccagataatgacacacgtccatggtgcttcgtctgg
agtggcgacaggctgagctgggactattgcggcctggagcagtgccagacgccaacgttt
gcacctctagttgtccctgagagtcaggaggagtccccgtcccaggcaccatctctgtcc
catgcaccaaatgactcgaccgatcatcagacttctctgtccaagaccaacacgatgggc
tgcggacagaggttccgcaagggactgtcctcgttcatgcgcgtggtgggcggactagtg
gctctgcctgggtcgcacccctacatcgctgcactgtactggggtaacaacttctgcgcg
ggcagtctcatcgccccctgttgggtgctgaccgcggctcactgcctgcagaatcggcca
gcgcccgaggaactgacagtggtacttggtcaagatcgccacaaccagagctgcgagtgg
tgccagactctggctgtgcgctcctaccgccttcacgagggcttctcctccatcacctac
cagcacgacttggctctgctgcgcctgcaggaaagcaaaaccaacagttgcgcgatcctg
tcacctcacgttcagcctgtgtgtctacccagcggcgcggccccaccctctgagacagtg
ctctgcgaggtggccggctggggtcaccagttcgagggggctgaagaatactccaccttc
ctgcaggaggcacaggttccctttatcgccctggatcgctgctccaactctaacgtgcac
ggagacgccattctccctgggatgctttgcgctggcttcttggagggaggcaccgatgcc
tgccagggtgactccgggggccctctggtgtgtgaggaaggaactgcagaacatcagctc
accctgcgcggagtcatcagctggggctccggctgtggtgaccgcaacaagcccggagtc
tacacagacgtggccaactacctggcttggatccagaagcatattgcttcataa

DBGET integrated database retrieval system