KEGG   Mus musculus (mouse): 59001
Entry
59001             CDS       T01002                                 

Gene name
Pole3, 1810034K18Rik, YBL, YBL1
Definition
(RefSeq) polymerase (DNA directed), epsilon 3 (p17 subunit)
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    59001 (Pole3)
   03410 Base excision repair
    59001 (Pole3)
   03420 Nucleotide excision repair
    59001 (Pole3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    59001 (Pole3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    59001 (Pole3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    59001 (Pole3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     59001 (Pole3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    59001 (Pole3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    59001 (Pole3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      59001 (Pole3)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C BUD22 SpoU_methylase RNA_pol_3_Rpc31 Myc_N TAF DUF4746 Astro_capsid_p CDC45 Pox_Ag35 FYDLN_acid DDHD NOA36 Serinc
Other DBs
NCBI-GeneID: 59001
NCBI-ProteinID: NP_067473
MGI: 1933378
Ensembl: ENSMUSG00000028394
Vega: OTTMUSG00000009021
UniProt: Q9JKP7 A0A0R4J091
Position
4; 4 B3
AA seq 145 aa
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQKGKKEASEQKKKDKDKKDSEEQDK
SREEEEEDEERLDEDDQNEEEEIDN
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcggagaggcccgaggacctaaatctgcccaacgccgtcatcaccaggatcatcaag
gaggcgctcccggacggtgtcaacatctccaaggaggcccgaagcgccatctcccgcgcc
gccagtgtcttcgttttgtatgccacatcctgtgccaataacttcgcaatgaaaggaaag
cgcaagactctcaatgccagtgacgtgctgtcagccatggaagagatggaattccagcga
ttcataacaccattgaaagaagctctagaagcgtacaggcgggagcagaaaggcaagaag
gaggcttcggagcaaaagaagaaggacaaagacaaaaaggattccgaagagcaagacaaa
agcagagaggaggaggaggaggatgaagagagactggacgaggacgaccagaacgaagag
gaggaaatagacaactga

DBGET integrated database retrieval system