KEGG   Mus musculus (mouse): 59007Help
Entry
59007             CDS       T01002                                 

Gene name
Ngly1, 1110002C09Rik, PNGase, Png1
Definition
(RefSeq) N-glycanase 1
  KO
K01456  peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase [EC:3.5.1.52]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    59007 (Ngly1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.52  peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase
     59007 (Ngly1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAW PUB Transglut_core Rad4
Motif
Other DBs
NCBI-GeneID: 59007
NCBI-ProteinID: NP_067479
MGI: 1913276
Ensembl: ENSMUSG00000021785
Vega: OTTMUSG00000023283
UniProt: Q9JI78
Structure
PDB: 

Position
14 A2; 14 7.08 cM
AA seq 651 aa AA seqDB search
MASATLGSSSSSASPAVAELCQNTPETFLEASKLLLTYADNILRNPSDEKYRSIRIGNTA
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSSKKV
QFSQHPAAAKLPLEQSEDPAGLIRHSGNQTGQLPSLPSAPMVVGDSTILKVLQSNIQHVQ
LYENPVLQEKALTCIPVSELKRKAQEKLFRARKLDKGTNVSDEDFLLLELLHWFKEEFFR
WVNNIVCSKCGGETRSRDEALLPNDDELKWGAKNVENHYCDACQLSNRFPRYNNPEKLLE
TRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPL
LYEIGWGKKLSYIIAFSKDEVVDVTWRYSCKHDEVMSRRTKVKEELLRETINGLNKQRQL
SLSESRRKELLQRIIVELVEFISPKTPRPGELGGRVSGSLAWRVARGETGLERKEILFIP
SENEKISKQFHLRYDIVRDRYIRVSDNNINISGWENGVWKMESIFRKVEKDWNMVYLARK
EGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSY
NDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggccacactgggcagctcgtcgagctctgcgtccccggccgtggccgagcta
tgccagaacaccccggagacctttctggaggcctccaagctgctgctcacctacgccgac
aacatcctgagaaaccccagtgatgaaaaatacagatccatccgtattgggaacacagcg
ttttctactagactcttgcctgtcagaggagctgttgagtgtttatttgaaatgggcttt
gaagagggagaaacgcatcttatctttcctaaaaaagcttcagtggaacagctacagaaa
atccgtgatctgattgccatagagagaagcagcagactggacggatccagtaagaaggtg
caattctctcagcacccggctgctgccaagcttcctctggagcagtctgaagatcctgct
gggttaatacggcactcaggaaaccaaacagggcagctgccaagcctaccctctgctcca
atggttgttggtgattcaaccatcttaaaagttcttcagtccaacattcagcatgtgcag
ctctatgaaaaccctgtcctccaggagaaagcattgacttgtatcccagtcagtgaacta
aaaagaaaagctcaagaaaagttattcagagctagaaagttagataaaggtactaatgta
agtgatgaggacttccttctactggagctcctacactggtttaaagaggagttttttcgc
tgggtgaataacattgtgtgcagcaaatgtggtggagagactagatctagagatgaggca
ttgctgcccaatgatgatgaactgaagtggggtgcaaagaatgtggagaatcattactgt
gatgcctgccagttgagcaaccgcttcccaagatataacaaccccgagaaacttttggaa
acaagatgtggacgctgtggtgaatgggccaattgttttactctgtgctgccgtgcatta
gggtttgaagctcgatatgtgtgggattacacagaccatgtttggacagaagtctattct
ccatctcagcagcggtggctacactgtgatgcatgtgaggatgtctgtgacaaacccctc
ctttatgaaataggatggggcaagaagctttcctatataatagcattctctaaagatgag
gtagttgatgtcacctggcgatactcttgtaaacatgatgaggtgatgtccaggaggacc
aaggttaaagaagagttacttcgagaaactattaatgggcttaataagcagagacagcta
tcattatcagaaagcagaaggaaagaacttctccagaggataattgtggagcttgttgaa
tttatatctcctaaaaccccaagacctggagaacttggtggaagggtatccgggtcattg
gcttggagagtggcccgaggtgagacgggtctagagagaaaggagattctgttcatccct
tctgaaaatgaaaagatttctaagcagtttcacctccgttatgatattgtgagagaccgt
tacattcgtgtctcagacaacaacataaacatttctggatgggagaatggtgtgtggaaa
atggaatccatattcagaaaagtcgagaaagactggaacatggtttatttggcccgaaaa
gaaggatcatcttttgcttatatttcctggaagtttgaatgtgggtcagctggtctaaaa
gtagatactgtttccatccgcacaagtagccaaagctttgagtctggatcagtgaggtgg
aaactgcgatctgagacagctcaagtcaacctgctgggagataaaaatctacgttcctat
aatgatttttctggtgccacagaggttacattagaagcagagttaagcagaggagatgga
gacgttgcttggcaacatacccaactgtttagacaaagcttaaatgacagtggagaaaat
ggcttggaaataattataacgttcaatgacctctga

DBGET integrated database retrieval system