KEGG   Mus musculus (house mouse): 59015
Entry
59015             CDS       T01002                                 
Symbol
Nup160, 160kDa, 2810011M03Rik, AA414952, AU020188, Gtl-13, Gtl1-13, Gtl13, mKIAA0197
Name
(RefSeq) nucleoporin 160
  KO
K14303  nuclear pore complex protein Nup160
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    59015 (Nup160)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    59015 (Nup160)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    59015 (Nup160)
   03036 Chromosome and associated proteins [BR:mmu03036]
    59015 (Nup160)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     59015 (Nup160)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    59015 (Nup160)
SSDB
Motif
Pfam: Nup160 TPR_2
Other DBs
NCBI-GeneID: 59015
NCBI-ProteinID: NP_067487
MGI: 1926227
Ensembl: ENSMUSG00000051329
UniProt: Q9Z0W3
Position
2:90504405..90569671
AA seq 1402 aa
MAAAGSLERSFVELSGAERERPRHFREFTVCDIGTASAAFGTVKYSESAGGFYYVESGKL
FSITRNRFIHWKTSGDTLELVEESLDLNLLNNAVRLKFQNYNILPGGVHVSETQNHVIIL
ILTNQTVHRLILPHPSRMYRSELVTESQMQSIFTDIGKVDFRDPCNSQLIPSVPGLSPGS
TTSAAWLSSDGEALFALPSASGGIFVLKLPPYDVPGIASVVELKQSSVMQRLLTGWMPTA
IRGDHGPSDRALSLAVHCVEHDAFIFALCQDHKLRMWSYKDQMCLMVADMLEYVPVNKDL
RLTAGTGHKLRLAYSPSMGLYLGIYMHAPKRGQFCVFQLVSTENNRYSLDHISSLFTSQE
TLVDFALTSTDIWALWHDAENQTIVKYINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPR
EMYLRSLFTPGHFINAALCKALQIFCRGTERNLDLSWNELKKEITLAVENELQGSVTEYE
FSQDEFRTLQQEFWCKFYACVLQYQEALSHPLALHLNPVTNMVCLLKKGYLSFLVPSSLV
DHLYLLPDEHLLTEDETTISDDADVARDVLCLIKCLRMIGESVTMDMAVLMETSCYNLQS
PEKAAEHILEDLITIDVENVMEDICSKLQEIRNPVHAIGLLIREMDYETEVEMEKGFDPA
QPLNVRMNLSQLYGSSTAGYIVCRGVYKIASTRFLICRDLLILQQLLTRLGDAVILGAGQ
LFQAQQDLLHRTAPLLLSYYLIKWASQCLATDVPVDTLESNLQHLSVLELTDSGALMANK
LVSSPQTIMELFFQEVARKQIISHLFSQPKAPLSQTGLNWPEMITAVTGYLLQLLWPSNP
GCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEVQKALECFCQAA
SEVGKEEFLDRLIRSEDGEIVSTPKLQYYDKVLRLLDVVGLPELVIQLATSAITEAGDDW
KSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFP
YVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRT
LRGLEKQGNCYLAAINCLRLIRPEYAWIVQPASGAVSDRPGASPKRNHDGECTAAPTNRQ
IEILELEDLEKEYSLARIRLTLARHDPSVIAIAGSSSAKEMSALLVQAGLFDTAISLCQT
FTLPLTPVFEGLAFKCIKLQFGGEAAQGEAWSWLATNQLSSVITTKESSATDEAWRLLST
YLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLV
SEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIILSQKILD
KLEDYQQKVDKATRDLLYRRDL
NT seq 4209 nt   +upstreamnt  +downstreamnt
atggcggcggcgggatccctggaacggagcttcgtggaactgagcggagctgaacgcgaa
aggcccaggcactttcgggaattcacagtctgcgacattgggactgcaagtgccgcgttt
ggaacggtgaagtacagtgagagcgctggtggcttctattatgtggaaagtggcaagttg
ttctccatcaccaggaacaggttcattcattggaagacttctggggatacattggagctg
gtggaagaatcactggacttaaatttgttgaataatgctgttcgcctaaaattccaaaat
tacaacatcttacccggtggggttcatgtctctgagactcagaatcatgtgataatctta
atattaaccaatcagacagtgcacagattaattttaccacacccttcccgtatgtacaga
agtgagctggtaactgaaagtcagatgcagtccatatttactgacattggaaaagttgat
ttcagagatccttgcaactctcagttaattccatcagtacctgggctgtccccgggttcc
accacgtctgcagcctggcttagcagcgatggggaggctctgttcgctctaccatctgct
tctggcggcatcttcgttcttaagctgcctccttatgacgtacctgggatagcatcagtt
gtggagctgaaacagagttccgtgatgcagcgattactcacaggctggatgcccacagct
ataaggggtgatcatgggccttctgatcgtgctctgagtctcgctgttcattgtgtggaa
catgatgcctttatttttgccctgtgtcaggatcataaacttcggatgtggtcttacaag
gaccaaatgtgcctgatggtggctgacatgctggaatatgtccctgtaaacaaagacctt
cggctcactgcaggaacaggacataaattacggcttgcgtattctccttccatggggctc
tacctaggaatatatatgcatgctccaaaacgaggacagttctgcgttttccagttggtg
agcactgagaataatcgctatagtttagatcacatttcttccctgttcacttctcaggag
acactagtcgattttgccttaacctcaacggatatctgggccctgtggcatgatgctgag
aaccaaacaattgtgaaatatatcaacttcgaacataatgttgcaggtcagtggaatcca
gtgtttatgcagcctctaccagaagaagaaattgtcatcagagacgatcaagaccccaga
gaaatgtatttgcggagcctttttacaccaggacacttcataaatgcagctttatgtaaa
gctttacagattttctgccgaggtaccgagaggaacttggatctttcatggaatgaacta
aaaaaggaaattactttagctgttgaaaatgagctccaaggaagtgtgacggagtatgaa
ttctcccaggatgaattccgcactttacaacaggaattctggtgcaagttctatgcctgc
gttctccagtatcaggaagccctctcccaccctcttgctctacatttgaatcctgtcaca
aacatggtgtgccttctcaagaaggggtatctgtctttcctggtgccatcttccttagta
gatcatttatatctcctgcccgatgagcaccttttgacagaggatgagacgaccatatca
gatgatgcagatgtggcacgggacgtcttatgtcttataaaatgcctccggatgattgga
gagtctgttaccatggacatggcagttttgatggaaaccagttgttacaacttgcaatct
ccagagaaggctgcggaacacattttggaagatttgatcactattgatgtagaaaatgtg
atggaagacatttgtagtaaactgcaagagatcagaaaccccgtccatgccattggactt
cttatacgggaaatggattatgaaacagaagtggaaatggaaaaggggttcgatccagct
cagcctttgaacgttcgaatgaatctttcccagctctatggtagtagcacagcaggatat
attgtgtgtcgaggtgtgtataaaattgccagcactcgattcctgatctgccgagacctc
ttgatcttgcagcagctattaacaaggctaggagatgcagtgatcttaggagctggtcag
ctctttcaagctcagcaagacctgctgcatcgcacagctcccctgctcttgtcttattac
ctcattaagtgggcaagtcagtgcttggcaactgatgtccccgttgacacactggagtct
aatctacaacatttgtcagttctggaactaactgattctggtgccttaatggcaaataaa
ctggtatctagccctcagacaattatggagttattcttccaagaagttgcaagaaaacaa
attatatctcatctcttctctcaacccaaagcccctctaagccaaactggattgaattgg
cctgaaatgattactgcagttactggttatttgttgcagcttttgtggcctagcaaccca
ggttgtctctttctagaatgtttgatggggaattgccagtatgtacaattgcaggattat
atccaactactgcatccctggtgtcaagtcaatgttgggtcttgtcgctttatgctggga
cggtgttacctggttacgggggaagtgcagaaggctctggaatgtttctgtcaggcagca
tctgaagtgggcaaagaagaatttttagatcgcttgatccgatcagaggacggggagatt
gtgtccacccccaagttgcagtattatgataaggttttacgtctactagacgttgttgga
ttgcctgagctggttattcagcttgctacatcagcaattactgaagcaggtgatgactgg
aaaagtcaggctactttaagaacatgcattttcaaacatcatttggacttgggtcataat
agccaagcatatgaggccttgacccaaattccggactccagcaggcagttagactgtttg
cgacagctggtggtggttctatgtgaacgctcccaactgcaggatcttgtagagtttccc
tatgtgaatctgcataatgaggttgtaggaataattgaatcacgtgctagagctgtggac
cttatgactcacaattactatgaacttctttatgcttttcacatttaccgccataattac
cgaaaagctggtacagtgatgtttgaatatggtatgcgtcttggcagagaggtacgaact
cttcggggacttgagaagcaaggcaactgttacctagccgctatcaattgtttacggctt
attcgtccagagtatgcgtggatcgtacagccagcctctggggcagtgtctgatcgccct
ggagcatctcctaagcggaatcatgatggcgagtgcacagctgccccaaccaatcggcaa
attgaaattctggaattggaagatctcgagaaagaatattctttagctcgcattcgcctc
acgttggctcggcatgatccatcagtgattgccattgcaggaagttcatcagcaaaggag
atgagcgcactcttggttcaggctggcctctttgatactgccatatcactctgtcagact
tttactcttccattaacaccagtctttgaagggcttgctttcaagtgcattaagttgcag
tttggaggagaagcagcacaaggagaagcgtggtcctggctagcaaccaatcagctgtcg
tctgtcatcaccaccaaggagtccagtgctacagatgaagcatggaggctattgtcaact
tacttggaaagatacaaagtccagaataacttgtatcatcattgtgtgattaacaagttg
ttgtctcatggagttcctctgcctaattggcttataaacagttacaagaaggttgatgct
gccgagttgcttcgtctttacctgaactatgaccttttagaagaagctgtggatttggtc
tctgaatatgtagatgctgtattaggaaaaggacatcagtactttggaattgagtttcca
ctgtcagcaacagccccgatggtatggctcccatactcttctattgaccagcttctccag
gctctgggagagaacagtgccaacagtcacaacattatactgtcccagaaaattcttgac
aaactagaagactaccagcaaaaagttgacaaggcaacgcgagatttactgtaccgtcgg
gacttgtga

DBGET integrated database retrieval system