KEGG   Mus musculus (mouse): 59021
Entry
59021             CDS       T01002                                 

Symbol
Rab2a, 9330148M11Rik, C80220, Ra, Rab2
Name
(RefSeq) RAB2A, member RAS oncogene family
  KO
K07877  Ras-related protein Rab-2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    59021 (Rab2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    59021 (Rab2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    59021 (Rab2a)
   04031 GTP-binding proteins [BR:mmu04031]
    59021 (Rab2a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    59021 (Rab2a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   59021 (Rab2a)
  Exosomal proteins of other body fluids (saliva and urine)
   59021 (Rab2a)
  Exosomal proteins of colorectal cancer cells
   59021 (Rab2a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    59021 (Rab2a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3
Other DBs
NCBI-GeneID: 59021
NCBI-ProteinID: NP_067493
MGI: 1928750
Ensembl: ENSMUSG00000047187
Vega: OTTMUSG00000004419
UniProt: P53994 Q0PD65
Position
4; 4 A1
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNASHGSNQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcctatctcttcaagtacatcatcatcggcgacacaggtgttggtaaatcg
tgcttattgctacagtttacagacaagaggtttcagccggtgcatgacctcacaattggt
gtagagtttggtgctcggatgataacgattgatgggaaacagataaaactccagatctgg
gatacagcagggcaggagtcctttcgttctatcacacggtcatattacagaggtgcagcg
ggggctttactagtgtatgatattacaaggagagacacgttcaaccacttgacaacctgg
ttagaagatgcccgtcagcattccaattccaacatggtcatcatgcttattggaaataaa
agtgacttagaatctaggagagaagtgaaaaaggaagaaggtgaagcttttgcacgagag
catggacttatcttcatggaaacttctgccaagactgcgtctaatgtagaggaggcattt
attaacacagcaaaagaaatttatgaaaaaatccaagaaggggtctttgacattaataat
gaggcaaacggcattaaaattggccctcagcacgctgctaccaacgcatctcatggaagc
aaccaaggcggacagcaggcagggggaggctgctgttga

DBGET integrated database retrieval system