KEGG   Mus musculus (house mouse): 59026
Entry
59026             CDS       T01002                                 
Symbol
Huwe1, 5430439H10Rik, AU041296, Arf-bp1, C430014N20Rik, C80292, Gm1718, Ib772, LASU1, Mule, Ureb1
Name
(RefSeq) HECT, UBA and WWE domain containing 1
  KO
K10592  E3 ubiquitin-protein ligase HUWE1 [EC:2.3.2.26]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    59026 (Huwe1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59026 (Huwe1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     59026 (Huwe1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   59026 (Huwe1)
SSDB
Motif
Pfam: DUF913 HECT UBM DUF908 WWE UBA Tam41_Mmp37
Other DBs
NCBI-GeneID: 59026
NCBI-ProteinID: NP_067498
MGI: 1926884
Ensembl: ENSMUSG00000025261
UniProt: Q7TMY8 Q3TNP1 Q4JG03 A2AFQ0
Position
X:150583779..150718413
AA seq 4378 aa
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEKEQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLQMLKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSL
KHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREV
LGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLG
SAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNH
AAEEASSEDEEEEEVQAMQSFNSAQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESI
LSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKV
LQEGLLQLDLILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAH
AYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSL
PSGCEFGQADMQKLVPKDEKAGTTQGGKRSDGEQDGTAGSMDASAQGLLEGIELDGDTLA
PMETDEPSSSDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVSEGLEHSDLPDGTGEFLD
AWLMLVEKMVNPTTVLESPHSLPAKLPGGVQSFPQFSALRFLVVTQKAAFTCIKNLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEEAGQEEGGSRREPQVNQQ
QLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIIGGVVRDLSMSEEDQMMRAIA
MSLGQDIPMDQRAESPEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFT
DTMLPGCFHLLDELPDTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAAL
PLTTSDTKTVSEWISQMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKL
LEVVQPCLQAAKEQKEVQTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWF
DDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVML
TLLRVPRLSKNSKSSNGQELEKTLEESKETDIKHKENKGNDIPLALESTNTEKEASLDET
KIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKS
TRMILNLTQSSGFNGFTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVVSG
SLGSREINYILRVLGPAACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKGPN
AVQLVKTTPLKPSSLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPKPGGTTQEVGQLL
QDMGDDVYQQYRSLTRQSSDFDTQSGFSLNSQVFAADGAPAETSTTGTSQGEGASTPEET
REGKKDKEGDRTSEEGKQKSKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQS
ELIKEDCSVLAFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAA
LGRALAMAESTEKHARLQAVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLKK
GLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASSKNKSEQDA
QGASQDSSSHQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVIAGQPEVLSS
QEMQVENELEDLIDELLERDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQAN
REDSMNILDPEDEEEHTQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDDD
DDGSEMELDEDYPDMNASPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLM
VRHADHSSLTLGSGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQR
LLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAG
TLSSIPTALTRWTEECKVLDAESMHDCVSVVKVPIVNHLEFLRDEELEERREKRRKQLAE
EETKIIDKGKEDKENRDQSAQCTVTKTNDSTEQNVSDGTPMPDSYPTTPSSTDAPTSESK
ETLGTLQPSQQQPALPPPPSLGEIPQELQSPAEEVANSTQLLMPIELEELGPTRPSGEAE
TTQMELSPAPTITSLSPERAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTPAAGS
SEQPTAGSSTPGDAPSVVAEVQGRPDVSRESNQPPEDSSPPASSESSSTRDSAVAISGAD
SRGILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRSAP
SSNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPMDPV
TFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTS
ALSAILRSPAFTSRLSGNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLLRLRGRL
LLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELC
IETPKLSTSEERGKKSSKSCASSSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCRTN
IFQIQRSGGRKHTEKHASSGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKET
NCESDRERGSKQACSPCSSQSSSSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSSGGE
GETSPHSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPENKVSEVQTNSSN
SGSSTAATSNTSTTTTTTTTATAPTPTPPAATTPVTSAPALVAATAISTITVAASTTVTT
PTTATTTVSTSTTKGSKSPAKVGEGGSGIDFKMVSSGLTENQLQLSVEVLTSHSCSEEGL
EDAANVLLQLSRGDSGTRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRAQC
ETLSPDGLPEEQPQTTKLKGKMQSRFDMAENVVIVASQKRPLGGRELQLPSMSMLTSKTS
TQKFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSASSIQAAVRQLEAEADAIIQM
VREGQRARRQQQAATSESSNQSETSVRREESPMDVDQPSPSAQDTQSIVISDGTPQGEKE
KEEKPPELPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERES
KPPVRDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSSLPPDTQKFL
RFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKED
MAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNP
MYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHI
LGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANI
LVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPT
IDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEG
MNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
NT seq 13137 nt   +upstreamnt  +downstreamnt
atgaaagtagacaggactaaactgaaaaagacacctactgaagctcctgcagactgcaga
gccttaatagacaaactcaaagtttgtaatgatgagcaactcctcttggaactgcagcaa
atcaaaacatggaacattggcaagtgtgagttatatcactgggtggatctgttggaccgc
tttgatggaattctggcagatgctggacaaacagtggagaatatgtcatggatgcttgta
tgtgataggccagaaaaagaacagctgaaaatgcttctattggctgtattgaacttcaca
gccttgctcattgagtacagcttttctcggcatctgtacagttccatagagcatttgaca
actttattggcttcctctgatatgcaagtggtgctggcagtccttaaccttctatatgta
tttagcaaaagatcaaactatatcacacgtcttggatctgacaagaggactccgctactg
acacggctgcagcatttggcagagagctggggtggaaaggagaatggctttggacttgca
gaatgttgcagagacttgcaaatgttgaaatatccacccagtgcaaccacactacacttt
gaattttatgcagatcctggagctgaggtcaaaattgagaagaggacaactagtaataca
ctacattatattcacatagaacaacttgacaagatttcagaaagtccttctgaaataatg
gaatctcttaccaaaatgtacagcattcctaaggataagcagatgctgttatttacacat
atacgactggcccatggcttttctaatcacaggaagcggttacaagctgttcaggccaga
ctgcatgcaatatctatattagtctattctaatgccttgcaagagtcagcaaacagtatc
ttgtataatgggttgatagaggagttggtagatgtccttcaaataacagataagcagctc
atggaaattaaagctgcttctttacgaacgttaacatcaattgttcatttggagagaact
cccaagctcagcagtattattgactgtactggaactgcctcctaccatggatttttgcct
gtacttgtgcggaactgcattcaggccatgattgatccttccatggacccatacccccat
cagtttgccacagctcttttctcctttttgtaccatctggctagctacgatgctggtggt
gaagccttggtctcctgtggaatgatggaagccttactaaaggtcataaagtttcttggt
gatgaacaagaccagataacatttgtaaccagagctgtcagagtggttgaccttatcacc
aacctggacatggcagcttttcagtctcatagtggtctttctatcttcatctatagactt
gagcacgaagtagatttgtgtcgtaaagaatgccctttcgtgatcaagccaaagatccag
agacccagtaccactcaagaaggagaagaaatggaaactgatatggatggagttcagtgt
attccacaacgagcagcacttctcaagtccatgttgaatttcctcaagaaggccattcaa
gaccctgctttctcagatggcatacgacatgtgatggatggttctttacctacctctctg
aaacacatcatcagcaatgcagaatactatggtccatcactcttcctcctagctactgaa
gtggtgactgtgtttgtatttcaagagccatcactgctgtcctcactccaggacaatgga
ctgacagatgtcatgctgcatgcactgctcatcaaagatgttcctgctacaagggaagtc
ctcggttccctcccaaatgtattcagtgcactttgcttgaatgcccgaggtcttcagtct
tttgtacaatgtcagccatttgaacgtctcttcaaagttcttctgtctcctgattacctc
ccagccatgcggaggaggaggagttctgatccccttggggatactgcatccaacctgggg
agtgctgttgatgagctcatgagacaccagcctaccctcaaaacagatgcaacaactgcc
atcatcaagttacttgaagaaatctgtaatcttggaagagatcctaaatacatttgtcag
aagccatctattcagaaagcggatggtactgctactgctcctcctccaaggtctaatcat
gctgcagaagaggcttccagtgaagatgaggaggaagaggaagtacaggccatgcagagc
tttaattctgcccagcagaatgaaactgagcctaatcagcaggtcgttggtaccgaggaa
cgtatacctatacccctcatggattacatccttaatgtgatgaaatttgtggaatctatt
ttgagcaacaatacaacagatgaccactgtcaagaatttgtaaaccagaaaggactctta
cctttggttaccattttgggtcttcccaatctgcccattgactttcccacatctgctgcc
tgtcaggctgttgcaggtgtctgcaaatccatattgaccctgtcacatgaacccaaagtt
cttcaagaaggtctccttcaattagacttgatcctttcctccttggagcctttacatcgg
ccgattgaatcccctgggggctcagtgttactgagagaattggcatgtgcaggcaatgtt
gctgatgctaccctctcagctcaggccacgcctctgttgcatgcactcactgcagcccat
gcttacatcatgatgtttgttcacacttgcagagttggacagagtgaaattcgttctatc
tcagtaaaccagtggggttcacaattgggtttgagtgttctgagcaagctaagccagtta
tactgttctctggtgtgggaaagcactgtcctcctctctctatgtacccccaacagccta
ccatctggatgtgaatttggtcaagcggacatgcagaaactagttccaaaggatgagaag
gcaggtacgacccagggcggaaaaagatcagatggagaacaggatggaactgctggaagc
atggatgcatctgcccagggtttattagaaggaattgaactagatggtgacacactggca
cccatggagacagatgaaccttcttcttcagattctaagggcaaatctaaaatcacacct
gccatggctgcaagaattaaacaaatcaagccgttgctgtcagcttcttccagattaggc
cgagcacttgctgagctctttggactccttgttaagctttgtgtgggttctcctgtccgc
caaaggaggagccatcatgctgccagtaccaccactgcaccaacacctgctgctagatca
acagcttcagccctcactaagctactcacaaaaggcttatcatggcagcccccaccatat
acacccactccccgcttcaggctgacgttcttcatctgttcagttggattcacctctcca
atgctctttgatgagagaaagtatccttaccaccttatgctgcagaaatttctctgctct
ggtggtcacaatgctctttttgaaactttcaactgggctctatccatgggaggaaaagtt
cctgtttctgagggattggaacattcagatctacctgatggtacaggagaattcctagat
gcctggcttatgcttgtagaaaagatggtaaatcccaccacggtgcttgaatctccacat
tcgttgcctgctaaattgcctggaggagtccagagctttccacaatttagtgcccttcgc
ttccttgtagtaactcaaaaagcagcctttacttgtatcaagaacctgtggaaccggaaa
ccccttaaagtatatgggggaagaatggctgagtctatgctggccattttgtgccacatt
ctccgaggggaacctgtgattcgagaaagactgagcaaagagaaggaaggatctcgagga
gaagaagaagcaggccaggaagaaggtggctcacgcagagaacctcaagtcaaccagcaa
cagctacaacagctcatggacatgggtttcacaagagaacatgccatggaggcactgttg
aataccagtacgatggaacaagcaacagagtaccttttaacccaccctcctccaatcata
ggaggagttgttcgggatcttagcatgtcagaagaggaccagatgatgagagcaattgct
atgtctctgggacaggatattccaatggatcaaagggcagagtcacctgaggaagttgct
tgccggaaggaggaagaagagcgtaaagctcgagaaaaacaagaagaggaagaagctaaa
tgtctagagaagtttcaagatgctgaccccttggaacaagatgagctccacactttcaca
gatacaatgttaccaggctgcttccatcttcttgatgagttgcctgatacagtgtaccgt
gtttgtgatctgatcatgacagctatcaaacgtaatggagctgactatcgtgatatgatt
ctaaagcaagttgtcaaccaggtgtgggaagctgctgatgtattgatcaaagctgctctt
cctctaacaacaagtgacacaaaaacagtttcagagtggatcagtcagatggctaccctg
ccacaggcctccaatttggctactagaatcttgcttttaacactactttttgaggagttg
aagttaccttgtgcctgggtggttgaatcaagtggcattcttaatgtcctaatcaaactc
ttagaagtggttcaaccctgcctacaggctgccaaagagcaaaaggaagtccagacccca
aagtggatcaccccagtgttgctccttattgatttttatgaaaagacagccatctcatca
aagagaagagcccaaatgactaagtacctacagtccaacagcaacaactggcgctggttt
gatgaccgctctgggcgttggtgtagttacagtgctagcaacaacagcaccattgattct
gcctggaaatctggagaaacaagtgtaagattcactgctggccgacgaagatacactgtc
cagttcactacaatggtgcaggttaatgaagaaacaggaaaccgacgccctgtgatgctg
actctcctcagggtgccacgactgagtaagaactcaaaaagcagcaatggacaggaacta
gagaagacactggaagaaagcaaggagaccgatatcaaacataaagaaaataaaggcaat
gatatccccttagctctagagagcacaaacactgaaaaagaggcaagcctggatgaaaca
aaaattggggagatcctaatccagggcctgacagaagatatggtgactgttctaatccgt
gcctgtgtgagcatgctgggagtccctgtggacccagacactttgcatgccacccttcgt
ctctgtttaaggctcacccgagaccacaaatatgccatgatgtttgcagaactgaagagt
acacgaatgatcttgaatttgacccagagctcaggtttcaatgggtttacccccttagtc
acccttctcttaaggcacatcattgaggatccttgtactcttcgtcatactatggaaaag
gttgttcgctcggcagccacaagtggagctggtagtactacatctggtgttgtatctggc
agcctcggttctcgggagatcaactatatccttagagtcctaggaccagctgcctgccgc
aatccagacatattcacagaagtagccaattgctgtatccgcattgcccttccagcccct
cgaggctcaggaactgcttcagatgatgaatttgagaatcttagaattaaaggtcctaat
gctgtacagctggtaaagacaacacctttgaagccctcatctctgcctgtcattcctgat
actattaaggaagttatctatgatatgctgaatgctttggctgcataccatgctccagag
gaagcagacaaatctgatcctaaacctgggggaacgacccaagaggttggccagctcctg
caagacatgggtgacgatgtataccagcagtaccggtcacttactcgtcagagcagtgac
tttgatacacagtcaggtttttccttaaatagtcaggtttttgctgcagatggtgcccct
gctgaaacttccacaactggaacctcccaaggagagggagcttcaactccagaggagact
cgagaagggaagaaagataaagaaggggaccgtacatctgaggaaggcaagcagaaaagc
aagggcagcaaacctttaatgcctacctctactatccttcgtcttctggcagagttggtg
aggtcctatgttggtattgctaccctgattgcaaactacagctataccgtgggccagtct
gagctgatcaaagaggactgcagtgtgctagcttttgtcctggaccacctcctcccacac
acccagaatgcagaagacaaggatacacctgccctggcacgtctattccttgcaagtctg
gctgctgcggggagtggcacagatgctcaagtggccctagtgaatgaagtgaaagcagcc
ctgggacgggcgcttgctatggctgagagtacagagaagcacgccagacttcaggcagtg
atgtgtatcatcagtactatcatggaatcctgcccctccacctccagcttctacagtagt
gctacagccaagactcagcataatggcatgaacaacatcattcgactgttcctaaagaag
ggactagtcaatgacctggccagagttcctcacagcctagacctgtccagtcccaatatg
gccaacacagtcaatgctgctctaaaacccttggaaacactttcccggattgtaaatcaa
cccagtagcctttttggcagcaagagtgcttctagcaagaacaagtctgagcaggatgct
caaggagcttctcaggactccagcagccatcagcaagatccaggcgagcctggggaggca
gaagtgcaggaggaggatcatgatgtcactcagacagaggtggcagatggggatatcatg
gatggggaggctgaaaccgactcagtggtgattgccgggcagcctgaggtgctcagttca
caagagatgcaggttgaaaatgaactggaggacctgatagatgagttgcttgagagggat
ggcggatctgggaacagtacaattatagtgagcagaagtggagaggatgaatcacaagag
gacgtgctgatggatgaagctccttccaacctcagccaagcttccaccttgcaggccaac
cgagaagattccatgaatatcctggaccctgaggatgaggaggaacatactcaggaagag
gacagcagtggcagtaacgaggatgaggatgatagtcaggatgaagaggaggaggaggag
gaagatgaggaagatgatcaggaggatgatgaaggtgaagaaggagatgaagatgatgac
gacgatggttctgagatggaattggatgaggattaccctgatatgaacgcttctcccttg
gtccgatttgagcgctttgaccgggaggatgatctcatcattgagtttgacaacatgttc
tccagtgctacagacattcccccatccccaggaaatatccctaccacccacccattgatg
gtacgtcatgcagatcacagttccctgacactgggcagtggttcttccacaactcgtctt
acccagggcatcggtcgcagtcaaaggaccctcagacagctcactgccaatacaggccat
accattcatgttcactaccctgggaatcgccagcctaaccctcctcttatactccagagg
ttgcttggtccctctgcagctgctgacattcttcagctgagcagcagccttccattacaa
agccgaggccgggcccgcctcctagtgggcaatgatgacgtccatatcatcgccaggtct
gatgacgagctgctggatgacttttttcatgaccagagtacagccactagccaagcagga
accctgtccagcatcccaacagctctaacccgatggacagaggaatgcaaagttcttgat
gctgagagtatgcatgactgtgtttcagtggttaaagtgcccattgtcaatcacctggaa
ttcttgagagatgaggagctagaagagagaagggagaaacgcaggaaacaattggctgag
gaagaaacaaaaataatagacaaaggcaaagaagacaaggagaacagagatcagagtgca
cagtgtactgtaactaagacaaatgactccactgaacagaatgtctcagatgggactcct
atgcctgacagctatccaacaaccccctcttcaacggatgcacctacatctgagtccaag
gaaacacttggtaccctacaaccctcccagcaacagccagcacttccacccccaccatcc
ttaggagagattcctcaggaactacagtcccctgctgaagaagtggcaaactctacacag
ctattgatgcctatagagttggaggaattgggtcccacaagaccaagtggagaagcagaa
acaactcaaatggaattgtctccagctcccaccataacctctctttccccagagagagct
gaagattcagacgcgttaacagctgtcagcagtcagctggaaggttctcccatggacacc
agcagcctggcttcctgtacgttagaagaggctgtgggtgacactccagcagctggcagt
tctgagcagcccacagcaggtagttccactcctggggatgcgccatcagttgtggcagaa
gtgcaaggcagacctgatgtatcaagagaatccaaccagccacctgaggacagctccccc
cctgcatcctcggagagttcttccactagagattctgccgtggccatctctggagcagat
tctcgtggaattctagaagagccactaccttcaacaagcagtgaagaagaagatcccctt
gctggtatcagtctccctgaaggtgtggatccctcctttctggctgctctccctgatgat
atccgtcgggaagtcctacagaaccagctgggcatacgtccaccaacccgaagtgctccc
tcctcaaatagctcagctcctgcagtagtggggaaccctggtgtaactgaagtgagccct
gagttcctggctgccctacctccagctattcaagaggaagtgctagcacagcagagagct
gaacagcagcgacgggaactggctcagaatgcgagctcagacacccccatggaccctgtg
actttcattcagactttgccctcagatctgcgccgtagtgtcctagaggatatggaagac
agtgtgttagctgtgatgccacctgacattgcagctgaggctcaagctctaagacgagaa
caagaagcccgacagcggcagctcatgcatgagcgtctttttggacacagtagtacttct
gcactctctgccattctccgaagcccggcttttaccagtcgcctgagtggcaaccgtggg
gtccagtatactcgccttgctgtacagaggggtggcaccttccagatggggggtagcagc
agccataataggccttctggcagtaatgtggacacactactccgcctccgaggacgactc
cttctagaccatgaagccctgtcttgcctcttggtcctactttttgtggatgagccaaag
ctcaatactagccgtctacaccgagtactgagaaatctctgctatcatgcccagacccgc
cactgggtcatccgcagcctcctgtccattttgcagcgcagcagtgaaagtgagttatgc
attgagacacctaagctctccacaagtgaagaaaggggcaagaaatcaagcaagagctgt
gcatcaagcagtcatgagaaccgtcccctggatctgctccacaagatggagtccaaaagt
tccaatcagctctcctggctctcagtatcaatggatgctgctttaggctgtaggactaac
atattccagattcaacgttctggagggcgtaaacatacagagaagcatgcaagcagtggt
tccactgtccacatccacccccaggctgctcctgttgtttgcagacatgttttggataca
ctcattcagttggccaaggtgtttcccagccactttacacagcagcggaccaaagaaaca
aactgtgagagtgatcgggaacggggcagtaagcaggcctgcagcccatgctcctcacag
tcctccagcagtggcatctgtacagacttctgggacttattggtaaaactggacaacatg
aatgttagccgaaaaggcaagaactccgtgaagtcagtaccagtgagctctggtggtgaa
ggggaaacttccccacacagccttgaagcctctccactggggcagctcatgaacatgttg
tcacatccagtcatccgccggagttctctcttaactgagaaactcctgagactcctctct
ctcatctcaattgctctcccagaaaacaaagtatcagaagtgcaaactaactccagcaac
agtggttcctccactgctgccacctcaaacacatctactactaccaccaccaccactact
gccactgcccccacgcccacacccccagctgcaactacccctgtcacttctgctccagct
ctggttgctgccacagctatttccaccattactgtagctgcttctaccacagtgactacc
cccacaactgctaccactactgtttcaacttctactactaaaggcagcaaatctccagca
aaggttggtgaaggaggcagtggtatagacttcaaaatggtgtcctctggcctcactgaa
aaccagctacagctctctgtagaggtgttgacatcccactcttgttctgaagaaggcttg
gaagatgcggccaatgtgttactgcagctctctcgtggggactctggtacccgggacact
gttcttaagctgctactaaatggagcccgccatctgggttataccctctgtaaacagata
ggtaccctactcgctgaactacgggaatataatctggagcagcagcggcgagcccaatgc
gagaccctctctcctgatggcctacctgaggagcaaccacagaccaccaaactgaaaggc
aaaatgcagagcaggtttgacatggctgaaaatgtggtaattgtggcatctcagaagcga
cccttgggtggccgggagctccagctgccttctatgtccatgttgacatccaagacatct
acccagaagttcttcttgagggtactacaggtcatcatccagctgcgggatgacacacga
cgagctaacaagaaagccaagcagacaggcaggctaggttcctccggtttaggctcagct
agcagcatccaggcagctgttcggcagctggaggctgaggctgatgccattatacaaatg
gtacgtgagggtcaaagggcgcggagacagcaacaagcagcaacgtcggagtcttctaac
cagtcagagacatctgtccggagagaggaatcgcccatggatgtggaccagccatctcct
agtgctcaagatactcagtccattgtaatctcagatggaacaccacagggagagaaggag
aaagaggagaaaccacctgagttacccctgctcagtgagcaactgagcctagatgaactg
tgggacatgctaggggaatgtttaaaagaactggaggaatctcatgaccagcatgcagta
ttagtgctacagcctgctgtcgaggccttctttttggtccatgccacagagcgggagagc
aagcctcctgtccgagatacccgtgagagccagctggcacacatcaaggatgaacctcct
ccactctcccccgcccccttaaccccagccactccatcctcccttgacccattcttctcc
agggagccctcatctatgcacatttcctcgagcctgccccctgacacacagaagttcctt
cgctttgcagagactcaccgcactgtgttaaaccagatactacggcagtctaccacccat
cttgctgatgggccttttgctgtcttggtagattatatccgtgtcctcgactttgatgtc
aagcgcaaatatttccgccaagagctggagcgtttggacgaagggctccggaaagaagat
atggcagtgcatgtccgccgtgaccatgtatttgaagactcctatcgtgagctgcatcgc
aaatctcctgaagaaatgaagaatcgattgtatatagtgtttgaaggagaagaagggcag
gatgctggggggctcctgcgagagtggtacatgatcatctctcgagagatgttcaaccct
atgtatgccttgttccgtacctcacctggtgaccgggtcacctacaccatcaatccatct
tcccactgtaaccccaaccacctcagctacttcaagtttgttggacgaattgtagccaaa
gctgtatatgacaaccgcctcctggagtgctactttactaggtctttctacaaacacatc
ttgggcaaatctgtcaggtatacagatatggagagtgaagattaccacttctaccagggc
ctagtttatctgcttgaaaatgatgtctctacattaggctatgacctcaccttcagcact
gaggttcaagaatttggagtatgtgaagttcgtgacctcaaacccaatggagccaacatc
ttggtaacagaggagaacaagaaggaatatgtacacctggtttgccagatgagaatgaca
ggagccatccgcaaacagctggcagccttcttggagggcttctatgaaatcattccaaag
cgcctcatatccatctttactgagcaggaattagagctgctcatatcagggctgcctacc
atcgacattgatgatctaaaatctaacactgagtaccacaagtaccaatccaactctatt
cagatccagtggttttggagagcattgcgttcctttgaccaagcagaccgtgccaagttc
ctccagtttgtcacaggtacttccaaggtacccctacaaggatttgctgcccttgaaggt
atgaatggcattcagaagtttcagattcatcgagatgacagatccacagatcgcctgcct
tcagctcacacatgttttaatcaactggacctgcctgcctatgagagctttgagaagctc
cgccacatgctactattggccatccaggaatgctctgaaggctttgggctggcctaa

DBGET integrated database retrieval system