KEGG   Mus musculus (mouse): 59029Help
Entry
59029             CDS       T01002                                 

Gene name
Psmd14, 2610312C03Rik, 3200001M20Rik, AA986732, Pad1, Poh1, rpm11
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05169  Epstein-Barr virus infection
Module
mmu_M00341  Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    59029 (Psmd14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    59029 (Psmd14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    59029 (Psmd14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59029 (Psmd14)
   03051 Proteasome [BR:mmu03051]
    59029 (Psmd14)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M67
   59029 (Psmd14)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    59029 (Psmd14)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     59029 (Psmd14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Motif
Other DBs
NCBI-GeneID: 59029
NCBI-ProteinID: NP_067501
MGI: 1913284
Ensembl: ENSMUSG00000026914
Vega: OTTMUSG00000013076
UniProt: O35593
Position
2; 2 C1.3
AA seq 310 aa AA seqDB search
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccagggcccacctaca
gatgctcctgccgtggacacagcagaacaagtttatatctcttccttggccttgctaaag
atgttaaaacatggtcgtgctggagtgcctatggaagttatgggtctaatgcttggtgaa
tttgttgatgattacaccgtcagagtgattgatgtgtttgctatgccacagtcaggaact
ggtgtcagtgttgaagcagttgatccagtgttccaagccaaaatgttggatatgctgaaa
caaacaggaaggcccgagatggttgttggttggtatcacagtcaccctggctttggctgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agactgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacgacttcaaat
ctgggccacttaaacaagccatctatccaggcattaattcacggactaaacagacattat
tactccatcactattaattaccggaaaaatgaactggaacagaagatgctgttaaatttg
cataagaagagttggatggaaggattgacacttcaggactacagtgaacactgtaaacac
aatgaatcggtggtaaaagaaatgttggaattagccaagaattataataaggctgtggaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggatccc
aaacgtcatttggaagaacatgtggatgtgcttatgacttcaaatattgtccagtgtttg
gccgcaatgttggatactgttgtatttaaataa

DBGET integrated database retrieval system