KEGG   Mus musculus (house mouse): 59036
Entry
59036             CDS       T01002                                 
Symbol
Dact1, 4921528D17Rik, AI115603, DAPPER, DAPPER1, FRODO, Frd1, Frodo1, MDpr1, MTNG3, THYEX3
Name
(RefSeq) dishevelled-binding antagonist of beta-catenin 1
  KO
K22154  dapper
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    59036 (Dact1)
SSDB
Motif
Pfam: Dapper LURAP DUF4530
Other DBs
NCBI-GeneID: 59036
NCBI-ProteinID: NP_067507
MGI: 1891740
Ensembl: ENSMUSG00000044548
UniProt: Q8R4A3
Position
12:71356658..71366881
AA seq 778 aa
MKPDAAREPEPLSPGRGAEAEGRWRERGEADTERQRTRERQEATLAGLAELGYLRQRQEL
LVRGALRCSGTVGTVAPRSGELRGDAAQRSRLEEKFLEENILLLRRQLNCLRRRDAGLLN
QLQELDKQISDLRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSC
HSSTCFCSPLEAALTISDGCPKSADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQSPMFL
LCLTGNTLREEEGLGSHASDICIGSELNATKTDNSLPSPSSLWSASHPASSKKMDGYILS
LVQKKTHPVRTNKPRTSVNADPTKGLLRNGSVCVRAPSGVPPGSSVNFKNTKQMCLPAGG
ITSLENGPFSPPKQRSKDSKTDQLESKRLALPESCSAGAAMEPQSKHVPKAAKAASQELT
RCQAGLGESMKESNQASAVSPKTSPGRGPVAPAESKALQLPKKMSQKNSLQAVPALDRPA
LDFKSEGSSQSLEEGHLVKAQFIPGQQAAARPHRAHRNPGVARSATLKARGQAAMEHGLP
TVREKPRAAGKKCRFPDDSDTNKKFRKTSAKGRRSGGLQDAGLPGRALGTGGHRAGSRAH
AHGREPVVAKPKHKRTDYRRWKSSAEVSYEEALRRARRARREHGAAYRVAVALPYASPYA
YVPSDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGDFVGESTTTSDSEE
SGGLIWSQFVQTLPIQTVTAPDLHTRPTKTFVKIKASHNLKKKILRFRSGSLKLMTTV
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaagccggacgcagcgcgcgagccggagccgctgagccccggccggggcgcggaggcc
gaggggcgctggcgcgagaggggcgaggcggacacggagcggcagcgtacccgcgagcgc
caggaggccacgctggcggggctggcggagctggggtacctgcggcaacgccaagagctg
ctggtgcgcggtgcgctgcgctgctccgggaccgtggggaccgtcgcgccgcgctccggg
gagctgcggggagacgcggcgcagcgcagccgcctggaggagaagttcctggaagagaac
atcttgctgctgcgaaggcagttgaattgtttgaggagaagagatgccggtttgttgaat
cagttgcaagaacttgacaagcagataagtgacctgagactggatgtggagaagacatct
gaagagcacctggagacagacagccggcctagctcagggttttatgagctgagtgatgga
gcttcgggctccctctctaactcctccaactccgtgttcagtgagtgtttgtccagttgc
cattccagcacctgcttctgcagccccttggaggcggccttgaccatctcagacggttgc
cccaaatctgcagatgtgaatcctaaataccagtgtgatcttgtgtctaaaaacgggaat
gacgtatatcgctaccccagtccacttcatgctgtggctgtgcagagcccaatgtttctc
ctttgtctgacgggcaacactctgagggaagaggaggggcttgggagccatgccagcgac
atctgcattggatctgaactgaacgccaccaaaacagacaattccctgccatctccaagc
agtttgtggtccgcttcccatcctgcatccagtaagaaaatggatgggtatattttgagc
ctcgtgcagaagaaaacacaccctgtaaggaccaataaacctagaaccagtgtgaacgct
gaccctaccaagggccttctgaggaatggaagtgtgtgtgtcagggcccctagtggcgtc
ccaccgggcagtagtgtgaactttaagaatacaaaacagatgtgtttgcccgctggggga
ataacctctttggaaaacgggccattctcccctcctaagcagaggtccaaagactcaaag
acagaccagttagaaagcaagaggttggctctgccggagagctgctcggcaggcgccgcc
atggaaccccaaagcaagcatgtgcccaaagccgccaaggcagcctctcaagagctcaca
aggtgtcaagccgggctgggggaatccatgaaggaaagcaatcaggcctccgctgtttct
cctaaaacaagtcctggcagaggccctgtcgcccccgcagagagcaaagccctgcagctc
ccgaaaaagatgtcgcagaagaacagcctccaggctgtgcccgcgctggacaggccggcc
ttggacttcaaaagcgagggctcatctcaaagcctcgaggaagggcatctggtgaaagct
cagttcattccggggcagcaggcggccgccaggcctcaccgtgcacacaggaacccgggt
gtcgcaaggagcgccaccttgaaggcccgcggccaggcagccatggaacacggcctgccc
accgtcagggagaaaccgcgggcagcaggcaagaagtgccgtttcccagacgactcggat
acaaataagaaattcaggaagacctccgccaagggccggcgcagtggcgggctgcaggac
gctggccttcccggtagggccctgggcaccggcggccatcgggcgggtagcagggcgcac
gcgcatggccgggagcccgtggtggccaaaccgaagcacaagcgaaccgactaccggcgg
tggaaatcgtcagccgaggtctcctacgaagaagccctgcggagggcccggagggctcgc
agggagcacggggctgcctaccgggtggctgtcgccctgccttacgccagcccctatgcc
tacgtgcccagcgactccgagtactcggcggagtgcgagtcgctcttccactccacggtg
gtggacaccagcgaggacgagcagagcaactacaccaccaactgcttcggcgacagcgag
tccagcgtgagcgaaggcgacttcgtgggcgagagcaccaccaccagcgactcagaggag
agcgggggtttaatctggtcccagtttgtccagactctcccgattcaaacggtcacggcc
ccagacctccacacccgtcccacaaaaacctttgtcaaaatcaaggcttcgcacaacctc
aagaagaagatcctccgtttccgctctggctctttgaaactgatgactaccgtttga

DBGET integrated database retrieval system