KEGG   Mus musculus (mouse): 59038
Entry
59038             CDS       T01002                                 

Gene name
Pxmp4, 3010018P03Rik, Pmp24
Definition
(RefSeq) peroxisomal membrane protein 4
  KO
K13350  peroxisomal membrane protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    59038 (Pxmp4)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 59038
NCBI-ProteinID: NP_067509
MGI: 1891701
Ensembl: ENSMUSG00000000876
Vega: OTTMUSG00000015921
UniProt: Q9JJW0
Position
2; 2 H1
AA seq 212 aa
MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSL
REKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHSFLAAFIGGLLLFGENN
NINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQP
SLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK
NT seq 639 nt   +upstreamnt  +downstreamnt
atggccgccccaccgcagctacaggctcttctccaggccgtcaacaagctgctgcgccag
cgccgctaccacgctgcgctggccgtgataaagggcttccggaacggggctgtctatgga
gtcaaaatccgggcccctcatgcactggtgatgacctttctcttcaggagcggcagtctc
agagagaagcttcaggccattctgaaagccacgtacatccactctcggaacctagcctgc
tttgtgtttgcctataagagtctccatgccctacagtcccatgtgcaaggcgagacccac
cagatgcactctttcctggctgccttcatcggggggctcctgctgtttggagagaacaat
aacattaatagccagatcaacatgtacctgacctcacgcgtcctgtacgccttgtgccgc
ctgggtgtggagaagggctatatccctgcgctcaagtgggacccgttccccttgcacact
gcggtgatttgggggctcgtgctgtggctttttgagtaccaccggcccactctgcagccc
tccctacagtcctccatgacctacctctacgaggacagcaacgtgtggcacgacctctca
gacttcctcatcttcaacaagagccacccctccaagtaa

DBGET integrated database retrieval system