KEGG   Mus musculus (mouse): 59042Help
Entry
59042             CDS       T01002                                 

Gene name
Cope, 1110005D17Rik, Cope1
Definition
(RefSeq) coatomer protein complex, subunit epsilon
  KO
K17268  coatomer subunit epsilon
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    59042 (Cope)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    59042 (Cope)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    59042 (Cope)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   59042 (Cope)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_E TPR_14 TPR_12 TPR_19 TPR_7 ANAPC3 TPR_2 TPR_16
Motif
Other DBs
NCBI-GeneID: 59042
NCBI-ProteinID: NP_067513
MGI: 1891702
Ensembl: ENSMUSG00000055681
Vega: OTTMUSG00000027332
UniProt: O89079
Structure
PDB: 

Position
8; 8 B3.3
AA seq 308 aa AA seqDB search
MAPPVPGAVSGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPEREVERDVFLYRAY
LAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASENQRDSIVLELDREMSRSVDVTNTTFL
LMAASIYFHDQNPDAALRTLHQGDGLECMAMTIQILLKLDRLDLARKELKKMQDQDEDAT
LTQLATAWVNLAVGGEKLQEAYYIFQELADKCSPTLLLLNGQAACHSAQGRWETAEGVLQ
EALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDAHRAHPFIKEYQAKENDFDRL
AMQYAPSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctcctccggttcctggcgcggtctctggcggctccggagaggtagatgagctgttc
gacgtgaagaacgctttctacatcggcagctaccagcagtgcatcaacgaggctcagcgc
gtgaagctctccagtcctgagcgggaagtagagagggatgtcttcctatacagagcatac
ctcgcacagaggaagtatggcgtggtcctggatgagatcaaaccctcctcggccccagaa
ctccaggctgtgcgcatgtttgctgagtaccttgccagtgagaaccagagggacagcatc
gtgctggagctggatcgggagatgagcaggagtgtggatgtgaccaataccactttcctg
ctcatggctgcctccatctacttccacgaccagaacccggatgcagccctgcgaaccctg
caccagggcgacggccttgagtgcatggccatgacgattcagatcctcctcaagctggac
aggctggacctagcccggaaggagctgaagaagatgcaggaccaagatgaggacgccacc
cttacccagctagccactgcctgggtcaacctggctgtgggtggtgagaagctacaagaa
gcctactacatattccaagagctggccgacaagtgctcccccacactgctgctgctcaat
ggccaggcagcctgccactcagcacagggccgctgggagactgcagagggtgtgctgcaa
gaggcactggacaaggacagcggccaccctgagaccctcatcaatctcattgtactgtca
cagcacctgggcaagccccctgaggtgacaaaccgatacttgtcacagctgaaggatgca
cacagggcccaccccttcatcaaggagtaccaggccaaggagaacgatttcgatcgcctg
gcaatgcagtatgcgcccagtgcttaa

DBGET integrated database retrieval system