KEGG   Mus musculus (house mouse): 59043
Entry
59043             CDS       T01002                                 
Symbol
Wsb2, Swip2, WSB-2
Name
(RefSeq) WD repeat and SOCS box-containing 2
  KO
K10342  WD repeat and SOCS box-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59043 (Wsb2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     59043 (Wsb2)
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 SOCS_box WDR54 Nup160 PD40
Other DBs
NCBI-GeneID: 59043
NCBI-ProteinID: NP_067514
MGI: 2144041
Ensembl: ENSMUSG00000029364
UniProt: O54929
Position
5:117495370..117516666
AA seq 404 aa
MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCVVKLVPWPLEEQ
FIPKGFEAKSRSSKNDPKGRGSLKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQAPD
VSCLILATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRI
WDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQS
SVVSCDFSPDSALLVTASYDTSVIMWDPYTGERLRSLHHTQLEPTMDDSDVHMSSLRSVC
FSPEGLYLATVADDRLLRIWALELKAPVAFAPMTNGLCCTFFPHGGIIATGTRDGHVQFW
TAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggaggccggagaggagccgctgctgctggctgaactcaagcctgggcgcccccaccag
ttcgactggaagtcaagctgtgagacctggagcgtggccttctcgccagacggttcctgg
ttcgcctggtctcaaggacactgcgtggtcaagctggtcccctggcccttagaggaacag
ttcatccctaaaggattcgaagccaagagccgaagcagcaagaatgacccaaaaggacgg
ggcagtctgaaggagaagacgctggactgtggccagattgtgtgggggctggccttcagc
ccatggccctctccacccagcaggaaactctgggcacgtcaccatccccaggcgcctgat
gtttcttgcctgatcctggccacaggtctcaacgatgggcagatcaagatttgggaggta
cagacaggcctcctgcttctgaatctttctggccaccaagacgtcgtgagagatctgagc
ttcacgcccagcggcagtttgattttggtctctgcatcccgggataagacacttcgaatt
tgggacctgaataagcacggtaagcagatccaggtgttatccggccatctgcagtgggtt
tactgctgctccatctcccctgactgtagcatgctgtgctctgcagctggggagaagtcg
gtctttctgtggagcatgcggtcctacacactaatccggaaactagaaggccaccaaagc
agtgttgtctcctgtgatttctctcctgattcagccttgcttgtcacagcttcgtatgac
accagtgtgattatgtgggacccctacaccggcgagaggctgaggtcacttcatcacaca
cagcttgaacccaccatggatgacagtgacgtccacatgagctccctgaggtccgtgtgc
ttctcacctgaaggcttgtatctcgctacggtggcagatgacaggctgctcaggatctgg
gctctggaactgaaggctccggttgcctttgctccgatgaccaatggtctttgctgcacg
ttcttcccacacggtggaattattgccacagggacgagagatggccatgtccagttctgg
acagctccccgggtcctgtcctcactgaagcacttatgcaggaaagccctccgaagtttc
ctgacaacgtatcaagtcctagcactgccaatccccaagaagatgaaagagttcctcaca
tacaggactttctag

DBGET integrated database retrieval system