KEGG   Mus musculus (mouse): 59046Help
Entry
59046             CDS       T01002                                 

Gene name
Arpp19, 19kDa, 2700024H10Rik, ARPP-19, AW559096, Arpp12
Definition
(RefSeq) cAMP-regulated phosphoprotein 19
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Endosulfine Ntox30
Motif
Other DBs
NCBI-GeneID: 59046
NCBI-ProteinID: NP_067523
MGI: 1891691
Ensembl: ENSMUSG00000007656
Vega: OTTMUSG00000036813
UniProt: P56212
Position
9; 9 D
AA seq 112 aa AA seqDB search
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcggaagtccccgaggcagcgtctgcggaggagcaaaaggaaatggaagataaa
gtaactagtccagagaaagctgaagaagcaaagttaaaggcaaggtatcctcacttggga
caaaagcctggagggtctgattttttaaggaaaagattgcagaaagggcaaaagtatttt
gattctggggactacaacatggcaaaagcaaagatgaagaacaagcagcttcctgctgca
gccccggataagacagaggtcactggtgaccacattcccactccacaggacctccctcag
cggaaaccgtccctggttgctagcaagctggctggctga

DBGET integrated database retrieval system