KEGG   Mus musculus (mouse): 59048
Entry
59048             CDS       T01002                                 

Symbol
C1galt1c1, 1500002I11Rik, AB030184, C1GalT2, C81205, Cosmc
Name
(RefSeq) C1GALT1-specific chaperone 1
  KO
K09653  C1GALT1-specific chaperone 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    59048 (C1galt1c1)
   00514 Other types of O-glycan biosynthesis
    59048 (C1galt1c1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    59048 (C1galt1c1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 3 chain
   59048 (C1galt1c1)
SSDB
Other DBs
NCBI-GeneID: 59048
NCBI-ProteinID: NP_067525
MGI: 1913493
Ensembl: ENSMUSG00000048970
Vega: OTTMUSG00000017234
UniProt: Q9JMG2
Position
X; X A3.3
AA seq 316 aa
MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDISKISEAERME
LSKSFRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMM
RKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQPFYLGHTVKSGDLEYVS
VDGGIVLSIESMKRLNSLLSVPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADG
KDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHV
FNDALVFLPPNGSEND
NT seq 951 nt   +upstreamnt  +downstreamnt
atgctttcagaaagcagttcctttttgaagggtgtgatgcttggaagcatcttctgtgcc
ttgatcactatgctaggccacattaggattggaaacagaatgcaccaccatgagcatcac
catctgcaagcccctaacaaagacgatatctcgaaaatttcagaggctgaacgcatggag
ctcagtaagagtttccgggtatactgtatagttcttgtaaaacccaaagatgtgagtctt
tgggctgcagtgaaggagacttggaccaaacactgtgacaaagcagaattcttcagttct
gaaaatgttaaagtgtttgagtcaattaatatggacacaaatgacatgtggttgatgatg
aggaaagcttacaaatatgcttatgatcaatacagggaccaatacaactggttcttcctt
gcacgccccactactttcgctgttattgaaaacctcaaatattttttgttaaaaaaggat
caatcccaacctttctatctcggacacactgtaaaatctggagaccttgaatatgtgagt
gtggatggaggaattgtcttaagcatagaatcaatgaaaagactcaacagtcttctcagt
gttcctgaaaagtgtcctgaacaaggaggaatgatttggaagatatctgaagataaacag
ctggcggtctgcctgaaatacgccggagtatttgcagaaaatgccgaagatgccgatgga
aaagatgtgtttaataccaaatccgttggccttttcattaaagaggcaatgactaaccaa
ccaaaccaggtagtagaaggctgttgctctgatatggctgttactttcaatggactgact
cctaatcagatgcacgtgatgatgtatggggtgtaccggcttagggcatttggacatgtt
ttcaatgatgcattggttttcttacctccaaatggttctgagaatgactga

DBGET integrated database retrieval system