KEGG   Mus musculus (mouse): 59050
Entry
59050             CDS       T01002                                 

Symbol
Nsa2, 5730427N09Rik, LN, LNR42, N, Nsa2p, Tinp1, Yr2, Yr29
Name
(RefSeq) NSA2 ribosome biogenesis homolog
  KO
K14842  ribosome biogenesis protein NSA2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    59050 (Nsa2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    59050 (Nsa2)
SSDB
Motif
Pfam: Ribosomal_S8e
Other DBs
NCBI-GeneID: 59050
NCBI-ProteinID: NP_067527
MGI: 1913883
Ensembl: ENSMUSG00000060739
UniProt: Q9CR47
Position
13; 13 D1
AA seq 260 aa
MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ
MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP
LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK
AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK
YAQVTNNPENDGCINAVLLV
NT seq 783 nt   +upstreamnt  +downstreamnt
atgccacaaaatgaatatattgaattgcaccgcaaacgatacggatatcgtttggactac
catgagaaaaagagaaagaaagaaggtcgggaggcccatgaacgttcaaagaaggcaaaa
aaaatgattggcctgaaggctaagctctaccataaacagcgccatgccgagaaaatacaa
atgaaaaagactattaagatgcatgagaagagaaacaccaagcagaaggatgatgagaag
acgccgcagggagcagtccctgcctatctgctggacagagagggccagtcgagagcaaaa
gtcctttctaacatgattaagcagaaacggaaagaaaaggcgggaaaatgggaggtccct
ctacccaaagttcgtgcccaaggagaaacagaagtattgaaagttattcggacaggaaaa
aggaaaaagaaggcatggaagagaatggttactaaagtctgttttgttggcgatggcttt
acaagaaaaccaccgaaatatgaaaggttcattaggcccatgggtctacgtttcaaaaaa
gcccatgtcacacaccctgagctgaaagctaccttttgcctgcctattctcggtgtgaaa
aagaatccatcgtccccattatatacaaccctgggtgtgatcaccaaaggtacagttatt
gaagtgaatgtgagcgagctgggccttgtgacacaaggaggcaaggtgatttggggaaag
tacgcccaagttaccaacaatcctgagaacgatgggtgcataaatgcggtcttgctggtc
tga

DBGET integrated database retrieval system