KEGG   Mus musculus (mouse): 59053
Entry
59053             CDS       T01002                                 

Gene name
Hgh1, Brp16, D15Ertd741e, Fam203a, MNCb-5873
Definition
(RefSeq) HGH1 homolog
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF383 DUF384
Other DBs
NCBI-GeneID: 59053
NCBI-ProteinID: NP_067530
MGI: 1930628
Ensembl: ENSMUSG00000022554
UniProt: Q8C3I8
Position
15 D3; 15 35.78 cM
AA seq 393 aa
MRGPGVGSGFSGERGLLEQEAGADTEAVELLPFLVLGARADLQAAAAQHVLALTGAGSGR
TLLAGQPELLRALVDLAVAPAPAPSRDASRALVNLAADPNVHWQLLAADPELPARLLRCV
LDPQWPWAEEAAAVLANLSREPAPCAALMEKLMAAEPERLGLERLVNALCTPSYNAAAPL
HYLGPLLSNLSQQAEVRAFLLDPDRCVVQRLLPLTQYTDSSVRRGGVVGTLRNCCFEHRH
HKWLLGAQVDILPFLLLPLAGPEEFSEEEMDQLPVDLQYLSPDKQREPDADIRKMLIEAV
MLLTATAPGRKQVRDQGAYLILRELHSWEPEPDVRMACEKLIQVLIGDEPEAGMENLLEV
QVPEDVEQQLQELDQQEQQELAQELRGNGAPHT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcggggaccgggagtaggttcggggttctctggtgagcgagggttgctagagcaggag
gctggcgcggacacggaggcggtggaactgctgcccttcctggtgctcggagcgcgagcc
gacctgcaggcggccgcggcgcagcacgtgctggcgctgactggtgcgggctcgggccgc
acgctgttggccggacagccagagttgttgcgggccttggtcgaccttgcggtggccccg
gccccagctccttcccgcgatgcctcccgcgcgctcgtgaacttggctgctgatcccaat
gtgcactggcagctgctggcggctgacccggagctgcccgcccgcctgctgcgctgcgtg
ttggaccctcagtggccctgggctgaagaggcggctgcagtgctggccaacctgagtcgc
gagccggctccgtgtgctgcgttaatggagaagctgatggccgctgagccggagcggttg
ggtctggagcgacttgtcaacgcgctgtgcacgccgagctacaacgcggccgcacccctg
cattacctggggccgctgctctccaaccttagccagcaggcggaggtgcgtgcttttctc
ctggacccagacaggtgcgtggtccaacggctgctgcctcttacccagtacacagattct
tcggtgcgcaggggcggggtggtgggaacacttcggaattgctgttttgagcatcgacat
cacaagtggttacttggggcccaagtcgacattctcccctttttgctactgcccttggct
gggcctgaagagttttccgaggaagaaatggaccagctgcctgttgacctgcagtacttg
tcaccagacaagcaacgggagccggacgctgacatccggaagatgctcatcgaagccgtc
atgctgctgacagccacggcacctggtcggaagcaggtacgggaccagggtgcctacttg
atccttcgagagctgcacagctgggagccagagcccgatgtgcggatggcttgcgaaaaa
cttatccaggtgcttattggtgatgagccagaggctggcatggaaaacctgctggaggtg
caggtacctgaagacgtggaacaacagctccaggagctcgaccagcaagagcaacaggag
ctcgctcaagagctaagaggcaacggtgccccacacacctga

DBGET integrated database retrieval system