KEGG   Mus musculus (mouse): 59058Help
Entry
59058             CDS       T01002                                 

Gene name
Bhlhe22, Beta3, Beta3a, Bhlhb5
Definition
(RefSeq) basic helix-loop-helix family, member e22
  KO
K09086  class B basic helix-loop-helix protein 4/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    59058 (Bhlhe22)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Pancreatic factors
    59058 (Bhlhe22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Dynactin_p22
Motif
Other DBs
NCBI-GeneID: 59058
NCBI-ProteinID: NP_067535
MGI: 1930001
Ensembl: ENSMUSG00000025128
Vega: OTTMUSG00000018225
UniProt: Q8C6A8 A0A0R4J056
Position
3; 3 A1
AA seq 355 aa AA seqDB search
MERGLHLGAAAASEDDLFLHKSLGTSAAKRLEAAFRSTPPGMDLSLAPPTRERPASSSSP
LGCFEPADPEGAGLLLPPPGGGGGASGGGGGVSVPGLLVGSAGVGGEPSLSSLPAGAALC
LKYGESAGRGSVAESSGGEQSPDDDSDGRCELVLRAGGPDPRASPGAGGGSAKVAEGCSN
AHLHGGSGLPPGGPTSGGGSGGGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELR
AVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAA
AAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTEKP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgggttgcacctcggtgcggcggccgcgagcgaagacgacctcttcctgcac
aagagcctgggcacctccgccgccaagcgcctggaggcggcttttcgctccacacccccg
ggcatggacctgtccctggcgcctccaactcgcgaacgcccggcgtcgtcctcgtcgccc
ctcggctgtttcgagcccgctgatcccgaaggggctgggctgctgctgcctccgcccgga
ggaggcggtggcgcgagcggcggcggcggcggggtgagtgtcccggggctgctcgtgggc
tcagcgggcgtggggggcgagccgagcctgagcagcctgccggcgggggctgccctgtgc
ctcaagtacggcgagagcgccggacgcggctccgtggccgagagcagcgggggcgagcag
agccccgacgacgacagcgacggccgctgcgagctggtgctgcgagccgggggccccgac
ccgcgggcatcgccgggagcggggggcggcagcgccaaggtggccgagggctgctccaac
gcccacttgcatggtggctcgggcctccccccggggggccccacaagtggcggcggaagc
ggcggcggtggcggcggcagcagcaagaaatccaaagagcagaaggcgttgcgcctcaac
atcaacgctcgcgagcgccggaggatgcacgacctgaacgacgctctggatgagctgcgc
gcggtcattccttacgcgcacagcccttcagtgcggaagctctccaaaatcgccacgctg
ctcctcgccaagaactacatcctcatgcaggcacaggccctggaggaaatgcggcgctta
gtcgcctacctcaaccaaggccaggccatctcggcagcctctcttcccagctccgcggcc
gcggctgcggcggccgctgccctgcacccggcgctcggcgcctacgagcaggcggccggc
tacccgttcagtgcagggctgccgcccgctgcctcctgccccgagaagtgtgccctattc
aacagcgtctcgtccagcctctgcaaacagtgcacggagaagccttaa

DBGET integrated database retrieval system