KEGG   Mus musculus (house mouse): 59079
Entry
59079             CDS       T01002                                 
Symbol
Erbin, 1700028E05Rik, Erbb2ip, mKIAA1225
Name
(RefSeq) Erbb2 interacting protein
  KO
K12796  erbb2-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    59079 (Erbin)
SSDB
Motif
Pfam: LRR_8 LRR_4 PDZ PDZ_6 LRR_5 PDZ_2
Other DBs
NCBI-GeneID: 59079
NCBI-ProteinID: NP_001276402
MGI: 1890169
Ensembl: ENSMUSG00000021709
UniProt: Q80TH2 B7ZNX6
Position
13:complement(103955294..104057094)
AA seq 1402 aa
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVPEVLEQLSGLREFWMDGNRLTFIPGFIGSLRQLTYLDVSKN
NIEMVEEGISTCENLQDFLLSSNSLQQLPETIGSLKNVTTLKIDENQLMYLPDSIGGLRS
IEELDCSFNEIEALPSSIGQLTNMRTFAADHNYLQQLPPEIGNWKNITVLFLHCNKLETL
PEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDTETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPALWEEQRKQRAQVAFECDEDKDEREAPPREGNL
KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEESGRDLKQHEDQQVVNKDKCVKTSESTT
TKSKLDEREKYMNSVQKMSEPEAETNGGNLPVTASMKLSGNLKHIVNHDDVFEESEELSS
DEEMKMAEMRPPLIESSINQPKVVALSNNKKDDAKDADSLSDEVTHNSNQNNSNCSSPSR
MSDSVSLNTDSSQDTSLCSPVKQTPVDSNSKVRQEDENFNSLLQNGVNLNNSPEEKFKIN
DKKDFKLPEYDLNIEEQLVLIEKDIDSKATSDDSRQLDHINMNINKLVTNNIFQPEVMER
SKMQDIVLGTGFLSIHPKNEAEHIENGAKFPNLESINKVNGLCEDTAPSPGRVEPQKASS
SADVGISKSTEDLSPQRSGPTGAVVKSHSITNMETGGLKIYDILGDDGPQPPSAAVKIAS
AVDGKNIVRSKSATLLYDQPLQVFTAASSSSELLSGTKAVFKFDSNHNPEEPDIIRAATV
SGPQSTPHLYGPPQYNVQYSGSATVKDTLWHPKQNPQIDPVSFPPQRLPRSESAENHSYA
KHSANMNFSNHNNVRANTGYHLQQRLAPARHGEMWAISPNDRLVPAVTRTTIQRQSSVSS
TASVNLGDPTRRTEGDYLSYRELHSMGRTPVMSGSQRPLSARAYSIDGPNTSRPQSARPS
INEIPERTMSVSDFNYSRTSPSKRPNTRVGSEHSLLDPPGKSKVPHDWREQVLRHIEAKK
LEKHPQTSSPGECCQDDRFMSEEQNHPSGALSHRGLPDSLMKMPLSNGQMGQPLRPQAHY
SQTHHPPQASVARHPSREQLIDYLMLKVAHQPPYTHPHCSPRQGHELAKQEIRVRVEKDP
ELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQ
AVSLLKTFHNAVDLIIVREVSS
NT seq 4209 nt   +upstreamnt  +downstreamnt
atgactacaaaacgaagtttgtttgtgcggttggtaccatgtcgctgtctacgaggagaa
gaggagacagtcactactctagattattctcattgcagcttggaacaagttcccaaagag
attttcacctttgaaaaaactttagaggagctctatttagatgctaatcagattgaagag
cttccaaagcaactttttaattgtcagtctctacataaactaagtttgccagacaatgat
ttaacaacattaccagcctccattgcaaatcttattaatctcagggaactggatgtcagc
aaaaatggaatacaagaatttccagaaaatattaaaaattgtaaagttttgacaattgtg
gaggctagtgtgaaccctatttctaagctccctgatgggttttctcagctgctaaaccta
acccagttatatctgaatgatgctttccttgaattcttaccagctaattttggcagatta
actaaactccagattctagaacttagagaaaaccagttgaaaatgttgcctaaaaccatg
aatagactgacccagctggaaaggctggatttgggaagtaatgaattcacagaagtgcct
gaagtacttgaacaactaagtggattgagagagttttggatggatggcaatagactgact
tttattccagggtttattggtagtttgagacagctcacgtacttggatgtttctaaaaat
aatattgaaatggttgaagaaggaatttcaacatgtgaaaacctccaggactttctctta
tcaagtaattcccttcagcagctgccggaaactattggttcattgaaaaatgtcacaact
ctaaaaattgatgaaaaccaattaatgtatctaccagactcaataggagggttaaggtca
atagaagaactggattgcagtttcaatgaaattgaagctttgccttcctcaattggccag
ctcacaaacatgagaacatttgctgcagatcacaattacttacaacagctacccccagag
attggaaactggaaaaatataactgtgctgtttctccattgtaataaactagagacgctt
ccagaggaaatgggtgatatgcaaaaattaaaagtcatcaatttaagtgataataggtta
aagaatttgccttttagctttacaaagctacaacagttgactgctatgtggctgtcagat
aatcagtccaaacctctgatacctcttcaaaaagaaacagacacagagactcagaaaatg
gtgcttactaattacatgttccctcagcagccacggactgaagacgttatgttcatatca
gataatgaaagttttaatcctgcattgtgggaagaacagagaaaacagcgggctcaagtg
gcatttgaatgtgatgaagacaaagatgaaagagaggcaccacccagggagggaaactta
aagagatatccaacaccatacccagatgagcttaagaatatggtcaagactgttcaaacc
attgtacatagattaaaagatgaagagactaatgaagagtctgggagagatttgaagcag
catgaagatcagcaagttgtaaataaggataagtgtgtgaagacttcagaaagtactaca
acaaaaagcaaacttgatgaaagagaaaagtatatgaattctgtacagaaaatgagtgag
cctgaagctgagaccaatggtggaaatttgccagtaactgcaagtatgaagttgtctgga
aacctgaagcatattgttaaccatgatgatgtttttgaggaatctgaagaactttcttct
gatgaagaaatgaaaatggcagagatgcgacctccattaattgaatcctcgattaatcag
cccaaagttgtagcacttagtaataataaaaaggatgatgcgaaggatgcagactcttta
tccgatgaagtcacacacaacagtaatcagaataacagcaactgttcttctccgtcccga
atgtctgattcagtgtctcttaatactgacagcagtcaagacacgtcactctgttctccc
gtgaaacagactcccgtggatagtaactccaaagtcagacaagaagatgaaaattttaac
agccttttacaaaatggagttaatttaaacaattcaccagaggaaaaattcaaaattaat
gataaaaaggattttaagttacctgagtatgatttgaatattgaagaacagttagttctg
attgaaaaagacattgattcaaaagccacatctgatgactctcgccagttagaccatatc
aacatgaatattaataaacttgtgaccaataatatttttcaaccagaagtaatggaaaga
tcaaagatgcaggatatagtacttggaacaggctttttaagtattcatcctaaaaatgag
gctgagcacatagaaaatggggctaagtttccgaatttggagtccataaataaggtaaat
ggtctttgtgaggacactgcaccgtctcctggtagggttgaaccacagaaggccagttct
tctgctgacgtgggcatttctaaaagcacggaagatctatctcctcagagaagtggtcca
actggagctgttgtgaaatctcatagtataactaacatggagactggaggtttaaaaatc
tatgacattcttggtgatgatggccctcagccgccaagtgcagcagttaaaatcgcatct
gctgtggatgggaagaacatagtcagaagcaagtctgccacactgctgtatgatcagccc
ctgcaggtgttcactgctgcctcctcatcttctgagttactgtcaggtacaaaggcagtt
ttcaagtttgattcaaatcacaaccctgaagagccagatataataagagctgccacagta
tctggcccacagtctacacctcacctgtatggtcccccacaatataatgtccagtacagt
ggcagtgctacagtgaaagacaccttgtggcaccctaaacagaatccacaaatagatcct
gtcagttttcctcctcagcgccttccaagatctgagagtgcagaaaatcacagttatgca
aagcattctgccaacatgaatttctctaaccataacaatgttagagccaatactggatac
cacttacaacagagacttgccccagccaggcatggagaaatgtgggctatctccccgaat
gaccgactagtgccagcagtcactcggactactattcagagacagagtagcgtgtcttca
acggcttctgtaaatctcggtgaccccacaaggcgtactgaaggagattacttatcgtac
agagagttacattcaatgggaagaactccagtcatgtcaggatcacagagacctctttct
gcacgagcgtacagcatcgatggcccaaatacatccaggcctcagagtgcccgtccctct
attaatgaaataccagagagaactatgtcagttagtgatttcaattactcacggactagt
ccttcaaaaagaccaaatacaagggtcgggtctgaacattctctgttagatcctccagga
aaaagcaaggttcctcatgactggcgggaacaagtactacgacacattgaggccaaaaag
ttagaaaagcatccgcagacatccagtccaggagagtgttgccaagatgatagattcatg
tcagaagagcagaaccacccatcaggtgcacttagtcacagaggtcttccagacagcctg
atgaaaatgcctttgagtaatggacaaatgggccagcctctcaggcctcaggcacattat
agtcaaacccatcacccccctcaggcatctgtggcaaggcatccctctagagaacaacta
attgattatttgatgctgaaagtggcccaccagcctccatatacacatccccattgttct
cctagacaaggccatgaactggcaaagcaagagattcgagtaagagtagaaaaggatcca
gaacttggatttagcatatcaggaggtgtcggcggcagaggaaaccctttcagacctgat
gatgatggtatatttgtaacaagggtacaacctgaaggaccagcatcaaaattactacag
ccaggagataaaattattcaggctaatggctacagttttatcaacattgaacatgggcaa
gcggtgtccttgttaaaaactttccataatgcagtagatctcatcattgtacgagaagtt
tcttcataa

DBGET integrated database retrieval system