KEGG   Mus musculus (house mouse): 59095
Entry
59095             CDS       T01002                                 
Symbol
Fxyd6, 0610030I18Rik, Php
Name
(RefSeq) FXYD domain-containing ion transport regulator 6
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    59095 (Fxyd6)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   59095 (Fxyd6)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 DUF6095 Ycf9 MpPF26 Glycophorin_A EphA2_TM
Other DBs
NCBI-GeneID: 59095
NCBI-ProteinID: NP_071287
MGI: 1890226
Ensembl: ENSMUSG00000066705
UniProt: Q9D164
Position
9:45280768..45307457
AA seq 94 aa
METVLVLCSLLAPVVLASAAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRC
KCSFNQKPRAPGDEEAQVENLITTNAAEPQKAEN
NT seq 285 nt   +upstreamnt  +downstreamnt
atggagacggtgctggtcctctgcagcttgctggcccctgtggtcctggcgagtgcagct
gagaaggagaaagaaaaggatcctttctattacgactaccagaccctgaggattgggggg
ttggtgtttgctgtggtcctcttctccgttgggatacttctcatcctcagtcgcaggtgc
aagtgcagtttcaatcagaagcccagggctccaggtgacgaagaggcccaggtggagaac
ctcatcactacaaacgctgcggagccccagaaggcagagaactga

DBGET integrated database retrieval system